PDB entry 6np2

View 6np2 on RCSB PDB site
Description: AAC-VIa bound to Sisomicin
Class: transferase
Keywords: Antibiotic modifying enzyme, substrate selectivity, ANTIBIOTIC, TRANSFERASE
Deposited on 2019-01-17, released 2019-09-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-06, with a file datestamp of 2019-11-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminoglycoside N(3)-acetyltransferase
    Species: Enterobacter cloacae [TaxId:550]
    Gene: aac 3-VI
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47030 (0-267)
      • variant (113)
    Domains in SCOPe 2.08: d6np2a_
  • Heterogens: SIS, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6np2A (A:)
tpwskselvrqlrdlgvrsgdmvmphvslravgpladgpqtlvdalieavgptgnilafv
swrdspyeqtlghdappaaiaqswpafdpdhapaypgfgainefirtypgcrrsahpdas
maaigpdaawlvaphemgaaygprspiarflahagkilsigagpdavtalhyaeavarie
gkrrvtysmpllregkrvwvttsdwdsngildeyaapdgpdaveriardylartrvaqgp
vggaqsrlidaadivsfgiewlearhaa