PDB entry 6noz

View 6noz on RCSB PDB site
Description: x-ray structure of pedv papain-like protease 2
Deposited on 2019-01-16, released 2020-01-22
The last revision was dated 2020-01-22, with a file datestamp of 2020-01-17.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyprotein
    Species: Porcine epidemic diarrhea virus [TaxId:28295]
    Database cross-references and differences (RAF-indexed):
    • Uniprot W8QLX4 (2-247)
      • expression tag (0-1)
  • Heterogens: ZN, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6nozA (A:)
snnwdshygfdkagefhmldhtgfafpsevvngrrvlkttdnncwvnvtclqlqfarfrf
ksaglqamwesyctgdvamfvhwlywltgvdkgqpsdsenalnmlskyivpagsvtierv
thdgcccskrvvtapvvnasvlklgvedglcphglnyidkvvvvkgttivvnvgkpvvap
shlflkgvsyttfldngngvaghytvfdhdtgmvhdgdvfvpgdlnvspvtnvvvseqta
vvikdpvk