PDB entry 6nok

View 6nok on RCSB PDB site
Description: The X-ray crystal structure of Streptococcus pneumoniae Fatty Acid Kinase (Fak) B1 protein loaded with myristic acid (C14:0) to 1.69 Angstrom resolution
Class: transferase
Keywords: Streptococcus pneumoniae, Fatty acid kinase, myristic acid, TRANSFERASE
Deposited on 2019-01-16, released 2019-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-21, with a file datestamp of 2019-08-16.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fatty Acid Kinase (Fak) B1 protein
    Species: Streptococcus pneumoniae [TaxId:1313]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DP17 (34-315)
      • expression tag (31-33)
    Domains in SCOPe 2.07: d6noka1, d6noka2
  • Heterogens: MYR, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6nokA (A:)
    mgsshhhhhhssglvprgshmasmtggqqmgrdpmklavftdssaylsaetlqredlfvl
    dipvnidgeeyveginlsaeefyqkmaqaselpktsqpsiakldeiltslkeqgythalg
    lflssgisgfyqsiqymvddyegltiafpdtlitsaplgimvesvfnwrdqgddfasiqd
    klaiqisrtsafimvddldhlvkggrlsngaailgnllsikpilyfndqgvievyekvrt
    ekkatkrlieiikettasgqyrvivihgnapekaeelrqhlldfglgsdvslatfgsvig
    thlgagsialgyipvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nokA (A:)
    rdpmklavftdssaylsaetlqredlfvldipvnidgeeyveginlsaeefyqkmaqase
    lpktsqpsiakldeiltslkeqgythalglflssgisgfyqsiqymvddyegltiafpdt
    litsaplgimvesvfnwrdqgddfasiqdklaiqisrtsafimvddldhlvkggrlsnga
    ailgnllsikpilyfndqgvievyekvrtekkatkrlieiikettasgqyrvivihgnap
    ekaeelrqhlldfglgsdvslatfgsvigthlgagsialgyipvi