PDB entry 6nnq

View 6nnq on RCSB PDB site
Description: Non-covalent structure of SENP1 in complex with SUMO2
Class: hydrolase/protein binding
Keywords: SUMOylation, SUMO2, SENP1, HYDROLASE-PROTEIN BINDING complex
Deposited on 2019-01-15, released 2019-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 2.62 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sentrin-specific protease 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SENP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9P0U3 (1-223)
      • expression tag (0)
    Domains in SCOPe 2.07: d6nnqa1, d6nnqa2
  • Chain 'B':
    Compound: Small ubiquitin-related modifier 3
    Species: Homo sapiens [TaxId:9606]
    Gene: SUMO3, SMT3A, SMT3H1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nnqb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6nnqA (A:)
    apeiteemekeiknvfrngnqdevlseafrltitrkdiqtlnhlnwlndeiinfymnmlm
    erskekglpsvhafntffftklktagyqavkrwtkkvdvfsvdillvpihlgvhwclavv
    dfrkknityydsmgginneacrillqylkqesidkkrkefdtngwqlfskksqipqqmng
    sdcgmfackyadcitkdrpinftqqhmpyfrkrmvweilhrkll
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6nnqB (B:)
    dhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpaq
    lemededtidvfqqqtgg