PDB entry 6nne

View 6nne on RCSB PDB site
Description: Crystal structure of Dihydrofolate reductase from Mycobacterium tuberculosis in complex with diaverdine
Class: oxidoreductase
Keywords: antifolate, OXIDOREDUCTASE
Deposited on 2019-01-14, released 2019-07-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-13, with a file datestamp of 2019-11-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: dihydrofolate reductase
  Species: Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) [TaxId:419947]
  Gene: dfrA, MRA_2788
  Database cross-references and differences (RAF-indexed):
  • Uniprot A5U6B6 (0-158)
  Domains in SCOPe 2.08: d6nnea_
• Chain 'B':
  Compound: dihydrofolate reductase
  Species: Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) [TaxId:419947]
  Gene: dfrA, MRA_2788
  Database cross-references and differences (RAF-indexed):
  • Uniprot A5U6B6 (0-158)
  Domains in SCOPe 2.08: d6nneb_
• Heterogens: KUP, CO, NDP, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6nneA (A:)
  mvgliwaqatsgvigrggdipwrlpedqahfreitmghtivmgrrtwdslpakvrplpgr
  rnvvlsrqadfmasgaevvgsleealtspetwvigggqvyalalpyatrcevtevdiglp
  reagdalapvldetwrgetgewrfsrsglryrlysyhrs
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6nneB (B:)
  mvgliwaqatsgvigrggdipwrlpedqahfreitmghtivmgrrtwdslpakvrplpgr
  rnvvlsrqadfmasgaevvgsleealtspetwvigggqvyalalpyatrcevtevdiglp
  reagdalapvldetwrgetgewrfsrsglryrlysyhrs