PDB entry 6nnb

View 6nnb on RCSB PDB site
Description: solution structure of the tudor domain of pshcp
Deposited on 2019-01-14, released 2019-08-21
The last revision was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Prochlorococcus/Synechococcus Hyper Conserved Protein
  Species: Prochlorococcus marinus (strain MIT 9303) [TaxId:59922]
  Gene: P9303_06811
  Database cross-references and differences (RAF-indexed):
  • Uniprot A2C7H2 (3-58)
    • expression tag (0-2)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >6nnbA (A:)
  snameldlqpgdvvkvlesaalgwvrarvirvksggrvvvqsdqgreftargnqvrlie