PDB entry 6nmw

View 6nmw on RCSB PDB site
Description: Crystal structure of the human Lyn SH3 domain
Class: oncoprotein
Keywords: LYN kinase, Src family kinase, non-receptor tyrosine kinase, SH3 domain, ONCOPROTEIN
Deposited on 2019-01-12, released 2019-04-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine-protein kinase lyn
    Species: Homo sapiens [TaxId:9606]
    Gene: LYN, JTK8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6nmwa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6nmwA (A:)
eqgdivvalypydgihpddlsfkkgekmkvleehgewwkakslltkkegfipsnyvakln
tlehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >6nmwA (A:)
eqgdivvalypydgihpddlsfkkgekmkvleehgewwkakslltkkegfipsnyvakln
tle