PDB entry 6nmn

View 6nmn on RCSB PDB site
Description: Ternary complex structure of the T130K mutant of ANT-4'' with Neomycin and ATP (No Pyrophosphate)
Class: transferase/ANTIBIOTIC
Keywords: Aminoglycoside nucelotidyl transferase (ANT) Aminoglycoside modifying enzymes (AGMEs) DNA polymerase, ANTIBIOTIC, transferase-ANTIBIOTIC complex
Deposited on 2019-01-11, released 2020-01-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kanamycin nucleotidyltransferase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57514 (3-255)
      • conflict (82)
    Domains in SCOPe 2.08: d6nmna1, d6nmna2
  • Chain 'B':
    Compound: kanamycin nucleotidyltransferase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57514 (3-255)
      • conflict (82)
    Domains in SCOPe 2.08: d6nmnb1, d6nmnb2
  • Heterogens: NMY, A, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6nmnA (A:)
    gshmngpiimtreermkivheikerildkygddvkaigvygslgrqtdgpysdiemmcvm
    steeaefshewttgewkvevnfdseeilldyasqvesdwplthgqffsilpiydsggyle
    kvyqtaksveaqkfhdaicaliveelfeyagkwrnirvqgpttflpsltvqvamagamli
    glhhricyttsasvlteavkqsdlpsgydhlcqfvmsgqlsdseklleslenfwngiqew
    terhgyivdvskripf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nmnA (A:)
    mngpiimtreermkivheikerildkygddvkaigvygslgrqtdgpysdiemmcvmste
    eaefshewttgewkvevnfdseeilldyasqvesdwplthgqffsilpiydsggylekvy
    qtaksveaqkfhdaicaliveelfeyagkwrnirvqgpttflpsltvqvamagamliglh
    hricyttsasvlteavkqsdlpsgydhlcqfvmsgqlsdseklleslenfwngiqewter
    hgyivdvskripf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6nmnB (B:)
    gshmngpiimtreermkivheikerildkygddvkaigvygslgrqtdgpysdiemmcvm
    steeaefshewttgewkvevnfdseeilldyasqvesdwplthgqffsilpiydsggyle
    kvyqtaksveaqkfhdaicaliveelfeyagkwrnirvqgpttflpsltvqvamagamli
    glhhricyttsasvlteavkqsdlpsgydhlcqfvmsgqlsdseklleslenfwngiqew
    terhgyivdvskripf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nmnB (B:)
    mngpiimtreermkivheikerildkygddvkaigvygslgrqtdgpysdiemmcvmste
    eaefshewttgewkvevnfdseeilldyasqvesdwplthgqffsilpiydsggylekvy
    qtaksveaqkfhdaicaliveelfeyagkwrnirvqgpttflpsltvqvamagamliglh
    hricyttsasvlteavkqsdlpsgydhlcqfvmsgqlsdseklleslenfwngiqewter
    hgyivdvskripf