PDB entry 6nmk

View 6nmk on RCSB PDB site
Description: Binary complex structure of the T130K mutant of ANT-4'' with Neomycin
Class: transferase/ANTIBIOTIC
Keywords: Aminoglycoside nucelotidyl transferase (ANT) Aminoglycoside modifying enzymes (AGMEs) DNA polymerase, ANTIBIOTIC, transferase-ANTIBIOTIC complex
Deposited on 2019-01-11, released 2020-01-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-01-15, with a file datestamp of 2020-01-10.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kanamycin nucleotidyltransferase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57514 (Start-255)
      • conflict (82)
    Domains in SCOPe 2.07: d6nmka1, d6nmka2
  • Chain 'B':
    Compound: kanamycin nucleotidyltransferase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57514 (3-255)
      • conflict (82)
    Domains in SCOPe 2.07: d6nmkb1, d6nmkb2
  • Heterogens: NMY, MG, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6nmkA (A:)
    gshmngpiimtreermkivheikerildkygddvkaigvygslgrqtdgpysdiemmcvm
    steeaefshewttgewkvevnfdseeilldyasqvesdwplthgqffsilpiydsggyle
    kvyqtaksveaqkfhdaicaliveelfeyagkwrnirvqgpttflpsltvqvamagamli
    glhhricyttsasvlteavkqsdlpsgydhlcqfvmsgqlsdseklleslenfwngiqew
    terhgyivdvskripf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nmkA (A:)
    ngpiimtreermkivheikerildkygddvkaigvygslgrqtdgpysdiemmcvmstee
    aefshewttgewkvevnfdseeilldyasqvesdwplthgqffsilpiydsggylekvyq
    taksveaqkfhdaicaliveelfeyagkwrnirvqgpttflpsltvqvamagamliglhh
    ricyttsasvlteavkqsdlpsgydhlcqfvmsgqlsdseklleslenfwngiqewterh
    gyivdvskripf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6nmkB (B:)
    gshmngpiimtreermkivheikerildkygddvkaigvygslgrqtdgpysdiemmcvm
    steeaefshewttgewkvevnfdseeilldyasqvesdwplthgqffsilpiydsggyle
    kvyqtaksveaqkfhdaicaliveelfeyagkwrnirvqgpttflpsltvqvamagamli
    glhhricyttsasvlteavkqsdlpsgydhlcqfvmsgqlsdseklleslenfwngiqew
    terhgyivdvskripf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nmkB (B:)
    mngpiimtreermkivheikerildkygddvkaigvygslgrqtdgpysdiemmcvmste
    eaefshewttgewkvevnfdseeilldyasqvesdwplthgqffsilpiydsggylekvy
    qtaksveaqkfhdaicaliveelfeyagkwrnirvqgpttflpsltvqvamagamliglh
    hricyttsasvlteavkqsdlpsgydhlcqfvmsgqlsdseklleslenfwngiqewter
    hgyivdvskripf