PDB entry 6nlt

View 6nlt on RCSB PDB site
Description: Apo structure of the T130K mutant of ANT-4
Class: antibiotic
Keywords: Aminoglycoside nucelotidyl transferase (ANT) Aminoglycoside modifying enzymes (AGMEs) DNA polymerase, ANTIBIOTIC
Deposited on 2019-01-09, released 2020-01-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-01-29, with a file datestamp of 2020-01-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kanamycin nucleotidyltransferase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: knt, kan
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05057 (3-255)
      • engineered mutation (132)
    Domains in SCOPe 2.07: d6nlta1, d6nlta2
  • Chain 'B':
    Compound: kanamycin nucleotidyltransferase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: knt, kan
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05057 (Start-255)
      • engineered mutation (132)
    Domains in SCOPe 2.07: d6nltb1, d6nltb2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6nltA (A:)
    gshmngpiimtreermkivheikerildkygddvkaigvygslgrqtdgpysdiemmcvm
    steeaefshewttgewkvevnfdseeilldyasqvesdwplthgqffsilpiydsggyle
    kvyqtaksveaqkfhdaicaliveelfeyagkwrnirvqgpttflpsltvqvamagamli
    glhhricyttsasvlteavkqsdlpsgydhlcqfvmsgqlsdseklleslenfwngiqew
    terhgyivdvskripf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nltA (A:)
    mngpiimtreermkivheikerildkygddvkaigvygslgrqtdgpysdiemmcvmste
    eaefshewttgewkvevnfdseeilldyasqvesdwplthgqffsilpiydsggylekvy
    qtaksveaqkfhdaicaliveelfeyagkwrnirvqgpttflpsltvqvamagamliglh
    hricyttsasvlteavkqsdlpsgydhlcqfvmsgqlsdseklleslenfwngiqewter
    hgyivdvskripf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6nltB (B:)
    gshmngpiimtreermkivheikerildkygddvkaigvygslgrqtdgpysdiemmcvm
    steeaefshewttgewkvevnfdseeilldyasqvesdwplthgqffsilpiydsggyle
    kvyqtaksveaqkfhdaicaliveelfeyagkwrnirvqgpttflpsltvqvamagamli
    glhhricyttsasvlteavkqsdlpsgydhlcqfvmsgqlsdseklleslenfwngiqew
    terhgyivdvskripf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nltB (B:)
    ngpiimtreermkivheikerildkygddvkaigvygslgrqtdgpysdiemmcvmstee
    aefshewttgewkvevnfdseeilldyasqvesdwplthgqffsilpiydsggylekvyq
    taksveaqkfhdaicaliveelfeyagkwrnirvqgpttflpsltvqvamagamliglhh
    ricyttsasvlteavkqsdlpsgydhlcqfvmsgqlsdseklleslenfwngiqewterh
    gyivdvskripf