PDB entry 6nlm

View 6nlm on RCSB PDB site
Description: 1.90 A resolution structure of WT BfrB from Pseudomonas aeruginosa in complex with a protein-protein interaction inhibitor (analog 15)
Class: oxidoreductase
Keywords: electron transport, iron storage, iron binding, iron mobilization, protein-protein interaction inhibitor, oxidoreductase
Deposited on 2019-01-08, released 2019-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nlma_
  • Chain 'B':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nlmb_
  • Chain 'C':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nlmc_
  • Chain 'D':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nlmd_
  • Chain 'E':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nlme_
  • Chain 'F':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nlmf_
  • Chain 'G':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nlmg_
  • Chain 'H':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nlmh_
  • Chain 'I':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nlmi_
  • Chain 'J':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nlmj_
  • Chain 'K':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nlmk_
  • Chain 'L':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nlml_
  • Heterogens: FE2, KT1, HEM, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6nlmA (A:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nlmA (A:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6nlmB (B:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nlmB (B:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6nlmC (C:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nlmC (C:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6nlmD (D:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nlmD (D:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmh
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6nlmE (E:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nlmE (E:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6nlmF (F:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nlmF (F:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmh
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6nlmG (G:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nlmG (G:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmh
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6nlmH (H:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nlmH (H:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmh
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6nlmI (I:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nlmI (I:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmh
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6nlmJ (J:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nlmJ (J:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmh
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >6nlmK (K:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nlmK (K:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmh
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6nlmL (L:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nlmL (L:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe