PDB entry 6nli

View 6nli on RCSB PDB site
Description: 1.90 A resolution structure of WT BfrB from Pseudomonas aeruginosa in complex with a protein-protein interaction inhibitor (analog 11)
Class: oxidoreductase
Keywords: electron transport, iron storage, iron binding, iron mobilization, protein-protein interaction inhibitor, oxidoreductase
Deposited on 2019-01-08, released 2019-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nlia_
  • Chain 'B':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nlib_
  • Chain 'C':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nlic_
  • Chain 'D':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nlid_
  • Chain 'E':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nlie_
  • Chain 'F':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nlif_
  • Chain 'G':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nlig_
  • Chain 'H':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nlih_
  • Chain 'I':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nlii_
  • Chain 'J':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nlij_
  • Chain 'K':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nlik_
  • Chain 'L':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nlil_
  • Heterogens: FE2, HEM, KTM, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6nliA (A:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nliA (A:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6nliB (B:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nliB (B:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6nliC (C:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nliC (C:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6nliD (D:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nliD (D:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6nliE (E:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nliE (E:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6nliF (F:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nliF (F:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6nliG (G:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nliG (G:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6nliH (H:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nliH (H:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6nliI (I:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nliI (I:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6nliJ (J:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nliJ (J:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >6nliK (K:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nliK (K:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6nliL (L:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nliL (L:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe