PDB entry 6nla

View 6nla on RCSB PDB site
Description: crystal structure of de novo designed metal-controlled dimer of b1 immunoglobulin-binding domain of streptococcal protein g (l12h, e15v, t16l, t18i, v29h, y33h, n37l)-zinc
Deposited on 2019-01-08, released 2019-01-23
The last revision was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: XRAY
Resolution: 1.34 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus [TaxId:1301]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19909 (1-55)
      • initiating methionine (0)
      • engineered mutation (11)
      • engineered mutation (14-15)
      • engineered mutation (17)
      • engineered mutation (28)
      • engineered mutation (32)
      • engineered mutation (36)
  • Heterogens: ZN, CL, GOL, NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6nlaA (A:)
    mtyklilngkthkgvltieavdaataekhfkqhandlgvdgewtyddatktftvte