PDB entry 6njj

View 6njj on RCSB PDB site
Description: Crystal Structure of the PDE4D Catalytic Domain and UCR2 Regulatory Helix with BPN14770
Class: hydrolase/hydrolase inhibitor
Keywords: PDE4D, CAMP-SPECIFIC 3'5'-CYCLIC PHOSPHODIESTERASE 4D, UCR2, cAMP, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2019-01-03, released 2019-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D, DPDE3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6njja_
  • Chain 'B':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D, DPDE3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6njjb_
  • Chain 'C':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D, DPDE3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6njjc_
  • Chain 'D':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D, DPDE3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6njjd_
  • Heterogens: ZN, MG, KR7, BTB, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6njjA (A:)
    msiprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfk
    ipvdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifa
    saihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkq
    rqslrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhc
    adlsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyi
    vhplwetwadlvhpdaqdildtlednrewyqstipqapappldeqnrdsqgnqvsefisn
    tfldenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6njjA (A:)
    qedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlitylm
    tledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpgv
    snqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvidi
    vlatdmskhmnlladlktmvetkkvtvllldnysdriqvlqnmvhcadlsnptkplqlyr
    qwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwadlvhp
    daqdildtlednrewyqstipnqvsefisntfld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6njjB (B:)
    msiprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfk
    ipvdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifa
    saihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkq
    rqslrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhc
    adlsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyi
    vhplwetwadlvhpdaqdildtlednrewyqstipqapappldeqnrdsqgnqvsefisn
    tfldenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6njjB (B:)
    qedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlitylm
    tledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpgv
    snqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvidi
    vlatdmskhmnlladlktmvetkkvtvllldnysdriqvlqnmvhcadlsnptkplqlyr
    qwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwadlvhp
    daqdildtlednrewyqstipnqvsefisntfld
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6njjC (C:)
    msiprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfk
    ipvdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifa
    saihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkq
    rqslrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhc
    adlsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyi
    vhplwetwadlvhpdaqdildtlednrewyqstipqapappldeqnrdsqgnqvsefisn
    tfldenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6njjC (C:)
    qedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlitylm
    tledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpgv
    snqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvidi
    vlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkplq
    lyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwadl
    vhpdaqdildtlednrewyqstipnqvsefisntfld
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6njjD (D:)
    msiprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfk
    ipvdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifa
    saihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkq
    rqslrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhc
    adlsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyi
    vhplwetwadlvhpdaqdildtlednrewyqstipqapappldeqnrdsqgnqvsefisn
    tfldenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6njjD (D:)
    qedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlitylm
    tledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpgv
    snqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvidi
    vlatdmskhmnlladlktmvetkkvtvllldnysdriqvlqnmvhcadlsnptkplqlyr
    qwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwadlvhp
    daqdildtlednrewyqstipnqvsefisntfld