PDB entry 6niw

View 6niw on RCSB PDB site
Description: Crystal structure of P[6] rotavirus
Class: virus
Keywords: Rotavirus, host receptor interaction, VIRUS
Deposited on 2019-01-01, released 2020-01-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-01-08, with a file datestamp of 2020-01-03.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease-sensitive outer capsid protein
    Species: Human rotavirus A [TaxId:10941]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6niwa_
  • Chain 'B':
    Compound: Protease-sensitive outer capsid protein
    Species: Human rotavirus A [TaxId:10941]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6niwb_
  • Chain 'C':
    Compound: Protease-sensitive outer capsid protein
    Species: Human rotavirus A [TaxId:10941]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6niwc_
  • Chain 'D':
    Compound: Protease-sensitive outer capsid protein
    Species: Human rotavirus A [TaxId:10941]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6niwd_
  • Heterogens: PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6niwA (A:)
    vldgpyqptnfkppndywillnptnqqvvlegtnktdiwvalllvepnvtnqsrqytlfg
    etkqitvenntnkwkffemfrsnvsaefqhkrtltsdtklagfmkfynsvwtfhgetpha
    ttdysstsnlsevetvihvefyiiprsqeskcseyintg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6niwA (A:)
    ldgpyqptnfkppndywillnptnqqvvlegtnktdiwvalllvepnvtnqsrqytlfge
    tkqitvenntnkwkffemfrsnvsaefqhkrtltsdtklagfmkfynsvwtfhgetphat
    tdysstsnlsevetvihvefyiiprsqeskcseyintg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6niwB (B:)
    vldgpyqptnfkppndywillnptnqqvvlegtnktdiwvalllvepnvtnqsrqytlfg
    etkqitvenntnkwkffemfrsnvsaefqhkrtltsdtklagfmkfynsvwtfhgetpha
    ttdysstsnlsevetvihvefyiiprsqeskcseyintg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6niwC (C:)
    vldgpyqptnfkppndywillnptnqqvvlegtnktdiwvalllvepnvtnqsrqytlfg
    etkqitvenntnkwkffemfrsnvsaefqhkrtltsdtklagfmkfynsvwtfhgetpha
    ttdysstsnlsevetvihvefyiiprsqeskcseyintg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6niwD (D:)
    vldgpyqptnfkppndywillnptnqqvvlegtnktdiwvalllvepnvtnqsrqytlfg
    etkqitvenntnkwkffemfrsnvsaefqhkrtltsdtklagfmkfynsvwtfhgetpha
    ttdysstsnlsevetvihvefyiiprsqeskcseyintg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6niwD (D:)
    dgpyqptnfkppndywillnptnqqvvlegtnktdiwvalllvepnvtnqsrqytlfget
    kqitvenntnkwkffemfrsnvsaefqhkrtltsdtklagfmkfynsvwtfhgetphatt
    dysstsnlsevetvihvefyiiprsqeskcseyintg