PDB entry 6nim

View 6nim on RCSB PDB site
Description: Trypanosoma cruzi - BDF2, TcCLB.506553.20, solved with bromosporine
Class: signaling protein
Keywords: TcCLB.506553.20, BDF2, bromosporine, Structural Genomics, Structural Genomics Consortium, SGC, SIGNALING PROTEIN
Deposited on 2018-12-29, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain factor 2 protein
    Species: Trypanosoma cruzi [TaxId:5693]
    Gene: C4B63_57g96
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nima_
  • Chain 'B':
    Compound: Bromodomain factor 2 protein
    Species: Trypanosoma cruzi [TaxId:5693]
    Gene: C4B63_57g96
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nimb_
  • Heterogens: SO4, UNX, BMF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6nimA (A:)
    gmgkrgregtldkarclafvhqlwdkdklkmfhhpisaaelpdyhkvinypvdlstirqg
    iesgkydsdadvqnavaqmianaleynakgtewhqqalsfrsiyldvarqcglsvdddaa
    y
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nimA (A:)
    gtldkarclafvhqlwdkdklkmfhhpisaaelpdyhkvinypvdlstirqgiesgkyds
    dadvqnavaqmianaleynakgtewhqqalsfrsiyldvarqcglsvdddaay
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6nimB (B:)
    gmgkrgregtldkarclafvhqlwdkdklkmfhhpisaaelpdyhkvinypvdlstirqg
    iesgkydsdadvqnavaqmianaleynakgtewhqqalsfrsiyldvarqcglsvdddaa
    y
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nimB (B:)
    gtldkarclafvhqlwdkdklkmfhhpisaaelpdyhkvinypvdlstirqgiesgkyds
    dadvqnavaqmianaleynakgtewhqqalsfrsiyldvarqcglsvdddaay