PDB entry 6ndr

View 6ndr on RCSB PDB site
Description: Crystal structure of dTDP-6-deoxy-D-glucose-3,5-epimerase RmlC from Legionella pneumophila Philadelphia 1 in complex with dTDP-4-KETO-L-RHAMNOSE
Class: sugar binding protein
Keywords: SSGCID, dTDP-4-dehydrorhamnose 3, 5-epimerase, dTDP-6-deoxy-D-glucose-3, RmlC, lpg0756, Legionella pneumophila, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SUGAR BINDING PROTEIN
Deposited on 2018-12-14, released 2018-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-26, with a file datestamp of 2018-12-21.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dtdp-4-dehydrorhamnose 3,5-epimerase
    Species: Legionella pneumophila subsp. pneumophila str. Philadelphia 1 [TaxId:272624]
    Gene: lpg0756
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5ZXH5 (8-194)
      • expression tag (7)
    Domains in SCOPe 2.07: d6ndra1, d6ndra2
  • Chain 'B':
    Compound: dtdp-4-dehydrorhamnose 3,5-epimerase
    Species: Legionella pneumophila subsp. pneumophila str. Philadelphia 1 [TaxId:272624]
    Gene: lpg0756
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5ZXH5 (8-194)
      • expression tag (7)
    Domains in SCOPe 2.07: d6ndrb1, d6ndrb2
  • Heterogens: TDO, EDO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ndrA (A:)
    mahhhhhhmniintqidelkiiepkiygdergffyesfqakryeellgitdrfvqdnfsr
    sqkgvlrglhyqsqqtqgklvsvlagevfdvavdirlgsptfgqwvgvilsgenkrqfwi
    pkgfahgfyvlsamadfaykctdyyhpesefsihyldpqlaidwplgeqvqlspkdaaak
    llnlidaellpryqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ndrA (A:)
    hmniintqidelkiiepkiygdergffyesfqakryeellgitdrfvqdnfsrsqkgvlr
    glhyqsqqtqgklvsvlagevfdvavdirlgsptfgqwvgvilsgenkrqfwipkgfahg
    fyvlsamadfaykctdyyhpesefsihyldpqlaidwplgeqvqlspkdaaakllnlida
    ellpryqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ndrB (B:)
    mahhhhhhmniintqidelkiiepkiygdergffyesfqakryeellgitdrfvqdnfsr
    sqkgvlrglhyqsqqtqgklvsvlagevfdvavdirlgsptfgqwvgvilsgenkrqfwi
    pkgfahgfyvlsamadfaykctdyyhpesefsihyldpqlaidwplgeqvqlspkdaaak
    llnlidaellpryqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ndrB (B:)
    hmniintqidelkiiepkiygdergffyesfqakryeellgitdrfvqdnfsrsqkgvlr
    glhyqsqqtqgklvsvlagevfdvavdirlgsptfgqwvgvilsgenkrqfwipkgfahg
    fyvlsamadfaykctdyyhpesefsihyldpqlaidwplgeqvqlspkdaaakllnlida
    ellpryqa