PDB entry 6ndf

View 6ndf on RCSB PDB site
Description: rhodocetin in complex with the integrin alpha2-a domain with strontium
Class: cell adhesion/toxin
Keywords: C-TYPE LECTIN, INTEGRIN, VENOM, COAGULATION, CELL ADHESION, CELL ADHESION-TOXIN complex
Deposited on 2018-12-13, released 2019-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-23, with a file datestamp of 2019-01-18.
Experiment type: XRAY
Resolution: 3.05 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Snaclec rhodocetin subunit gamma
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ndfa_
  • Chain 'B':
    Compound: Snaclec rhodocetin subunit delta
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ndfb_
  • Chain 'C':
    Compound: Integrin alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGA2, CD49B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ndfc_
  • Chain 'D':
    Compound: Snaclec rhodocetin subunit gamma
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ndfd_
  • Chain 'E':
    Compound: Snaclec rhodocetin subunit delta
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ndfe_
  • Chain 'F':
    Compound: Integrin alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGA2, CD49B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ndff_
  • Chain 'G':
    Compound: Snaclec rhodocetin subunit gamma
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ndfg_
  • Chain 'H':
    Compound: Snaclec rhodocetin subunit delta
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ndfh_
  • Chain 'I':
    Compound: Integrin alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGA2, CD49B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ndfi_
  • Chain 'J':
    Compound: Snaclec rhodocetin subunit gamma
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ndfj_
  • Chain 'K':
    Compound: Snaclec rhodocetin subunit delta
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ndfk_
  • Chain 'L':
    Compound: Integrin alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGA2, CD49B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ndfl_
  • Chain 'M':
    Compound: Snaclec rhodocetin subunit gamma
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ndfm_
  • Chain 'N':
    Compound: Snaclec rhodocetin subunit delta
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ndfn_
  • Chain 'O':
    Compound: Integrin alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGA2, CD49B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ndfo_
  • Chain 'P':
    Compound: Snaclec rhodocetin subunit gamma
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ndfp_
  • Chain 'Q':
    Compound: Snaclec rhodocetin subunit delta
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ndfq_
  • Chain 'R':
    Compound: Integrin alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGA2, CD49B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ndfr_
  • Heterogens: SO4, SR, NA, CL, NH4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ndfA (A:)
    dfnclpgwsaydqhcyqafnepktwdeaerfcteqakrghlvsigsdgeadfvaqlvtnn
    ikrpelyvwiglrdrrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysd
    cqaknpfvckfpsec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ndfA (A:)
    nclpgwsaydqhcyqafnepktwdeaerfcteqakrghlvsigsdgeadfvaqlvtnnik
    rpelyvwiglrdrrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysdcq
    aknpfvckfps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ndfB (B:)
    cplhwssyngycyrvfselktwedaesfcyaqhkgsrlasihsreeeafvgklasqtlky
    tsmwlglnnpwkeckwewsddakldykvwlrrpycavmvvktdrifwfnrgcektvsfvc
    kfys
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ndfB (B:)
    cplhwssyngycyrvfselktwedaesfcyaqhkgsrlasihsreeeafvgklasqtlky
    tsmwlglnnpwkeckwewsddakldykvwlrrpycavmvvktdrifwfnrgcektvsfvc
    kf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6ndfC (C:)
    mgsshhhhhhssglvprggspslidvvvvcdesnsiypwdavknflekfvqgldigptkt
    qvgliqyannprvvfnlntyktkeemivatsqtsqyggdltntfgaiqyarkyaysaasg
    grrsatkvmvvvtdgeshdgsmlkavidqcnhdnilrfgiavlgylnrnaldtknlikei
    kaiasipteryffnvsdeaallekagtlgeqifsieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ndfC (C:)
    lidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntykt
    keemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgsm
    lkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaall
    ekagtlgeqif
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6ndfD (D:)
    dfnclpgwsaydqhcyqafnepktwdeaerfcteqakrghlvsigsdgeadfvaqlvtnn
    ikrpelyvwiglrdrrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysd
    cqaknpfvckfpsec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ndfD (D:)
    nclpgwsaydqhcyqafnepktwdeaerfcteqakrghlvsigsdgeadfvaqlvtnnik
    rpelyvwiglrdrrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysdcq
    aknpfvckfps
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6ndfE (E:)
    cplhwssyngycyrvfselktwedaesfcyaqhkgsrlasihsreeeafvgklasqtlky
    tsmwlglnnpwkeckwewsddakldykvwlrrpycavmvvktdrifwfnrgcektvsfvc
    kfys
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ndfE (E:)
    cplhwssyngycyrvfselktwedaesfcyaqhkgsrlasihsreeeafvgklasqtlky
    tsmwlglnnpwkeckwewsddakldykvwlrrpycavmvvktdrifwfnrgcektvsfvc
    kf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6ndfF (F:)
    mgsshhhhhhssglvprggspslidvvvvcdesnsiypwdavknflekfvqgldigptkt
    qvgliqyannprvvfnlntyktkeemivatsqtsqyggdltntfgaiqyarkyaysaasg
    grrsatkvmvvvtdgeshdgsmlkavidqcnhdnilrfgiavlgylnrnaldtknlikei
    kaiasipteryffnvsdeaallekagtlgeqifsieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ndfF (F:)
    lidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntykt
    keemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgsm
    lkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaall
    ekagtlgeqif
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6ndfG (G:)
    dfnclpgwsaydqhcyqafnepktwdeaerfcteqakrghlvsigsdgeadfvaqlvtnn
    ikrpelyvwiglrdrrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysd
    cqaknpfvckfpsec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ndfG (G:)
    nclpgwsaydqhcyqafnepktwdeaerfcteqakrghlvsigsdgeadfvaqlvtnnik
    rpelyvwiglrdrrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysdcq
    aknpfvckfps
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6ndfH (H:)
    cplhwssyngycyrvfselktwedaesfcyaqhkgsrlasihsreeeafvgklasqtlky
    tsmwlglnnpwkeckwewsddakldykvwlrrpycavmvvktdrifwfnrgcektvsfvc
    kfys
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ndfH (H:)
    cplhwssyngycyrvfselktwedaesfcyaqhkgsrlasihsreeeafvgklasqtlky
    tsmwlglnnpwkeckwewsddakldykvwlrrpycavmvvktdrifwfnrgcektvsfvc
    kf
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6ndfI (I:)
    mgsshhhhhhssglvprggspslidvvvvcdesnsiypwdavknflekfvqgldigptkt
    qvgliqyannprvvfnlntyktkeemivatsqtsqyggdltntfgaiqyarkyaysaasg
    grrsatkvmvvvtdgeshdgsmlkavidqcnhdnilrfgiavlgylnrnaldtknlikei
    kaiasipteryffnvsdeaallekagtlgeqifsieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ndfI (I:)
    lidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntykt
    keemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgsm
    lkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaall
    ekagtlgeqif
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6ndfJ (J:)
    dfnclpgwsaydqhcyqafnepktwdeaerfcteqakrghlvsigsdgeadfvaqlvtnn
    ikrpelyvwiglrdrrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysd
    cqaknpfvckfpsec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ndfJ (J:)
    nclpgwsaydqhcyqafnepktwdeaerfcteqakrghlvsigsdgeadfvaqlvtnnik
    rpelyvwiglrdrrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysdcq
    aknpfvckfps
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >6ndfK (K:)
    cplhwssyngycyrvfselktwedaesfcyaqhkgsrlasihsreeeafvgklasqtlky
    tsmwlglnnpwkeckwewsddakldykvwlrrpycavmvvktdrifwfnrgcektvsfvc
    kfys
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ndfK (K:)
    cplhwssyngycyrvfselktwedaesfcyaqhkgsrlasihsreeeafvgklasqtlky
    tsmwlglnnpwkeckwewsddakldykvwlrrpycavmvvktdrifwfnrgcektvsfvc
    kf
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6ndfL (L:)
    mgsshhhhhhssglvprggspslidvvvvcdesnsiypwdavknflekfvqgldigptkt
    qvgliqyannprvvfnlntyktkeemivatsqtsqyggdltntfgaiqyarkyaysaasg
    grrsatkvmvvvtdgeshdgsmlkavidqcnhdnilrfgiavlgylnrnaldtknlikei
    kaiasipteryffnvsdeaallekagtlgeqifsieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ndfL (L:)
    lidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntykt
    keemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgsm
    lkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaall
    ekagtlgeqif
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >6ndfM (M:)
    dfnclpgwsaydqhcyqafnepktwdeaerfcteqakrghlvsigsdgeadfvaqlvtnn
    ikrpelyvwiglrdrrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysd
    cqaknpfvckfpsec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ndfM (M:)
    nclpgwsaydqhcyqafnepktwdeaerfcteqakrghlvsigsdgeadfvaqlvtnnik
    rpelyvwiglrdrrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysdcq
    aknpfvckfps
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >6ndfN (N:)
    cplhwssyngycyrvfselktwedaesfcyaqhkgsrlasihsreeeafvgklasqtlky
    tsmwlglnnpwkeckwewsddakldykvwlrrpycavmvvktdrifwfnrgcektvsfvc
    kfys
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ndfN (N:)
    cplhwssyngycyrvfselktwedaesfcyaqhkgsrlasihsreeeafvgklasqtlky
    tsmwlglnnpwkeckwewsddakldykvwlrrpycavmvvktdrifwfnrgcektvsfvc
    kf
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >6ndfO (O:)
    mgsshhhhhhssglvprggspslidvvvvcdesnsiypwdavknflekfvqgldigptkt
    qvgliqyannprvvfnlntyktkeemivatsqtsqyggdltntfgaiqyarkyaysaasg
    grrsatkvmvvvtdgeshdgsmlkavidqcnhdnilrfgiavlgylnrnaldtknlikei
    kaiasipteryffnvsdeaallekagtlgeqifsieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ndfO (O:)
    lidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntykt
    keemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgsm
    lkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaall
    ekagtlgeqif
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >6ndfP (P:)
    dfnclpgwsaydqhcyqafnepktwdeaerfcteqakrghlvsigsdgeadfvaqlvtnn
    ikrpelyvwiglrdrrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysd
    cqaknpfvckfpsec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ndfP (P:)
    nclpgwsaydqhcyqafnepktwdeaerfcteqakrghlvsigsdgeadfvaqlvtnnik
    rpelyvwiglrdrrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysdcq
    aknpfvckfps
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >6ndfQ (Q:)
    cplhwssyngycyrvfselktwedaesfcyaqhkgsrlasihsreeeafvgklasqtlky
    tsmwlglnnpwkeckwewsddakldykvwlrrpycavmvvktdrifwfnrgcektvsfvc
    kfys
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ndfQ (Q:)
    cplhwssyngycyrvfselktwedaesfcyaqhkgsrlasihsreeeafvgklasqtlky
    tsmwlglnnpwkeckwewsddakldykvwlrrpycavmvvktdrifwfnrgcektvsfvc
    kf
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >6ndfR (R:)
    mgsshhhhhhssglvprggspslidvvvvcdesnsiypwdavknflekfvqgldigptkt
    qvgliqyannprvvfnlntyktkeemivatsqtsqyggdltntfgaiqyarkyaysaasg
    grrsatkvmvvvtdgeshdgsmlkavidqcnhdnilrfgiavlgylnrnaldtknlikei
    kaiasipteryffnvsdeaallekagtlgeqifsieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ndfR (R:)
    lidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntykt
    keemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgsm
    lkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaall
    ekagtlgeqif