PDB entry 6nby

View 6nby on RCSB PDB site
Description: T.elongatus NDH (composite model)
Class: oxidoreductase
Keywords: photosynthesis, bioenergetics, membrane protein complex, OXIDOREDUCTASE
Deposited on 2018-12-10, released 2019-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-27, with a file datestamp of 2019-02-22.
Experiment type: EM
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD(P)H-quinone oxidoreductase subunit 1
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: NAD(P)H-quinone oxidoreductase subunit 2
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: NAD(P)H-quinone oxidoreductase subunit 3
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: NAD(P)H-quinone oxidoreductase chain 4 1
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: NAD(P)H-quinone oxidoreductase subunit 4L
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: NADH dehydrogenase subunit 5
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: nadh-quinone oxidoreductase subunit j
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: NAD(P)H-quinone oxidoreductase subunit H
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nbyh_
  • Chain 'I':
    Compound: NAD(P)H-quinone oxidoreductase subunit I
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: NAD(P)H-quinone oxidoreductase subunit J
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: NAD(P)H-quinone oxidoreductase subunit K
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: NAD(P)H-quinone oxidoreductase subunit L
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: NAD(P)H-quinone oxidoreductase subunit M
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: NAD(P)H-quinone oxidoreductase subunit N
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: NAD(P)H-quinone oxidoreductase subunit O
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: Proton-translocating NADH-quinone dehydrogenase subunit P NdhP
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
    • PDB 6NBY (Start-43)
  • Chain 'Q':
    Compound: Proton-translocating NADH-quinone dehydrogenase subunit Q NdhQ
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
    • PDB 6NBY
  • Chain 'S':
    Compound: Tlr0636 protein
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SF4

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6nbyH (H:)
    mpkietrtepmvinmgphhpsmhgvlrlmvtldgedvidcepvigylhrgmekiaenrtn
    imfipyvsrwdyaagmfneavtvnapeklagipvpkrasyirvimlelnrianhllwlgp
    fladvgaqtpffyifrereyiydlfeaatgmrfinnnyfriggvaadltygwvtkcrdfc
    dyflpkvdeyerlitnnpifvrrlqgvgkisreeainwglsgpmlrasgvkwdlrkvdhy
    ecyddfdwdvpvategdclaryivriqemresvkiirqaldglpggpyenleakrmlega
    ksewngfdyqyigkklsptfkipkgehyvrvesgkgelgiyligddnvfpwrwkirppdf
    nnlqvlpqllkgmkvadivailgsidvimgsvdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nbyH (H:)
    kietrtepmvinmgphhpsmhgvlrlmvtldgedvidcepvigylhrgmekiaenrtnim
    fipyvsrwdyaagmfneavtvnapeklagipvpkrasyirvimlelnrianhllwlgpfl
    advgaqtpffyifrereyiydlfeaatgmrfinnnyfriggvaadltygwvtkcrdfcdy
    flpkvdeyerlitnnpifvrrlqgvgkisreeainwglsgpmlrasgvkwdlrkvdhyec
    yddfdwdvpvategdclaryivriqemresvkiirqaldglpggpyenleakrmlegaks
    ewngfdyqyigkklsptfkipkgehyvrvesgkgelgiyligddnvfpwrwkirppdfnn
    lqvlpqllkgmkvadivailgsidvimgsvdr
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'S':
    No sequence available.