PDB entry 6nbq

View 6nbq on RCSB PDB site
Description: T.elongatus NDH (data-set 1)
Class: oxidoreductase
Keywords: photosynthesis, bioenergetics, membrane protein complex, OXIDOREDUCTASE
Deposited on 2018-12-09, released 2019-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-27, with a file datestamp of 2019-02-22.
Experiment type: EM
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: NdhA
  Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
  Database cross-references and differences (RAF-indexed):
  • PDB 6NBQ (Start-24)
  • PDB 6NBQ (25-End)
• Chain 'B':
  Compound: NAD(P)H-quinone oxidoreductase subunit 2
  Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8DMR6
• Chain 'C':
  Compound: NAD(P)H-quinone oxidoreductase subunit 3
  Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8DJ02
• Chain 'D':
  Compound: NAD(P)H-quinone oxidoreductase chain 4 1
  Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8DKY0
• Chain 'E':
  Compound: NAD(P)H-quinone oxidoreductase subunit 4L
  Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8DL29 (0-100)
• Chain 'F':
  Compound: NADH dehydrogenase subunit 5
  Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8DKX9
• Chain 'G':
  Compound: nadh-quinone oxidoreductase subunit j
  Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8DL30
• Chain 'H':
  Compound: NAD(P)H-quinone oxidoreductase subunit H
  Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8DJD9 (Start-393)
  Domains in SCOPe 2.07: d6nbqh_
• Chain 'I':
  Compound: NAD(P)H-quinone oxidoreductase subunit I
  Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8DL31
• Chain 'J':
  Compound: NAD(P)H-quinone oxidoreductase subunit J
  Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8DJ01 (Start-167)
• Chain 'K':
  Compound: NAD(P)H-quinone oxidoreductase subunit K
  Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8DKZ4
• Chain 'L':
  Compound: NAD(P)H-quinone oxidoreductase subunit L
  Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8DKZ3 (Start-75)
• Chain 'M':
  Compound: NAD(P)H-quinone oxidoreductase subunit M
  Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8DLN5 (0-110)
• Chain 'N':
  Compound: NAD(P)H-quinone oxidoreductase subunit N
  Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8DJU2
• Chain 'O':
  Compound: NAD(P)H-quinone oxidoreductase subunit O
  Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8DMU4 (Start-69)
• Chain 'P':
  Compound: Proton-translocating NADH-quinone dehydrogenase subunit P NdhP
  Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
  Database cross-references and differences (RAF-indexed):
  • Uniprot V5V507 (Start-43)
• Chain 'S':
  Compound: Tlr0636 protein
  Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8DL61
• Heterogens: SF4

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  Sequence, based on SEQRES records: (download)
  

  >6nbqH (H:)
  mpkietrtepmvinmgphhpsmhgvlrlmvtldgedvidcepvigylhrgmekiaenrtn
  imfipyvsrwdyaagmfneavtvnapeklagipvpkrasyirvimlelnrianhllwlgp
  fladvgaqtpffyifrereyiydlfeaatgmrfinnnyfriggvaadltygwvtkcrdfc
  dyflpkvdeyerlitnnpifvrrlqgvgkisreeainwglsgpmlrasgvkwdlrkvdhy
  ecyddfdwdvpvategdclaryivriqemresvkiirqaldglpggpyenleakrmlega
  ksewngfdyqyigkklsptfkipkgehyvrvesgkgelgiyligddnvfpwrwkirppdf
  nnlqvlpqllkgmkvadivailgsidvimgsvdr
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6nbqH (H:)
  kietrtepmvinmgphhpsmhgvlrlmvtldgedvidcepvigylhrgmekiaenrtnim
  fipyvsrwdyaagmfneavtvnapeklagipvpkrasyirvimlelnrianhllwlgpfl
  advgaqtpffyifrereyiydlfeaatgmrfinnnyfriggvaadltygwvtkcrdfcdy
  flpkvdeyerlitnnpifvrrlqgvgkisreeainwglsgpmlrasgvkwdlrkvdhyec
  yddfdwdvpvategdclaryivriqemresvkiirqaldglpggpyenleakrmlegaks
  ewngfdyqyigkklsptfkipkgehyvrvesgkgelgiyligddnvfpwrwkirppdfnn
  lqvlpqllkgmkvadivailgsidvimgsvdr
  

  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  No sequence available.
  
  
• Chain 'K':
  No sequence available.
  
  
• Chain 'L':
  No sequence available.
  
  
• Chain 'M':
  No sequence available.
  
  
• Chain 'N':
  No sequence available.
  
  
• Chain 'O':
  No sequence available.
  
  
• Chain 'P':
  No sequence available.
  
  
• Chain 'S':
  No sequence available.