PDB entry 6n9g

View 6n9g on RCSB PDB site
Description: Crystal Structure of RGS7-Gbeta5 dimer
Class: signaling protein
Keywords: RGS, G protein SIGNALING, SIGNALING PROTEIN
Deposited on 2018-12-03, released 2019-01-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: XRAY
Resolution: 2.13 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulator of G-protein signaling 7
    Species: Bos taurus [TaxId:9913]
    Gene: RGS7
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Regulator of G-protein signaling 7
    Species: Bos taurus [TaxId:9913]
    Gene: RGS7
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Guanine nucleotide-binding protein subunit beta-5
    Species: Mus musculus [TaxId:10090]
    Gene: Gnb5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6n9gc_
  • Chain 'D':
    Compound: Guanine nucleotide-binding protein subunit beta-5
    Species: Mus musculus [TaxId:10090]
    Gene: Gnb5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6n9gd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6n9gC (C:)
    matdglhenetlaslkseaeslkgkleeeraklhdvelhqvaervealgqfvmktrrtlk
    ghgnkvlcmdwckdkrrivsssqdgkvivwdsfttnkehavtmpctwvmacayapsgcai
    acggldnkcsvypltfdknenmaakkksvamhtnylsacsftnsdmqiltasgdgtcalw
    dvesgqllqsfhghgadvlcldlapsetgntfvsggcdkkamvwdmrsgqcvqafethes
    dvnsvryypsgdafasgsddatcrlydlradrevaiyskesiifgassvdfslsgrllfa
    gyndytinvwdvlkgsrvsilfghenrvstlrvspdgtafcsgswdhtlrvwa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n9gC (C:)
    tdglhenetlaslkseaeslkgkleeeraklhdvelhqvaervealgqfvmktrrtlkgh
    gnkvlcmdwckdkrrivsssqdgkvivwdsfttnkehavtmpctwvmacayapsgcaiac
    ggldnkcsvypltfdknenmaakkksvamhtnylsacsftnsdmqiltasgdgtcalwdv
    esgqllqsfhghgadvlcldlapsetgntfvsggcdkkamvwdmrsgqcvqafethesdv
    nsvryypsgdafasgsddatcrlydlradrevaiyskesiifgassvdfslsgrllfagy
    ndytinvwdvlkgsrvsilfghenrvstlrvspdgtafcsgswdhtlrvwa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6n9gD (D:)
    matdglhenetlaslkseaeslkgkleeeraklhdvelhqvaervealgqfvmktrrtlk
    ghgnkvlcmdwckdkrrivsssqdgkvivwdsfttnkehavtmpctwvmacayapsgcai
    acggldnkcsvypltfdknenmaakkksvamhtnylsacsftnsdmqiltasgdgtcalw
    dvesgqllqsfhghgadvlcldlapsetgntfvsggcdkkamvwdmrsgqcvqafethes
    dvnsvryypsgdafasgsddatcrlydlradrevaiyskesiifgassvdfslsgrllfa
    gyndytinvwdvlkgsrvsilfghenrvstlrvspdgtafcsgswdhtlrvwa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n9gD (D:)
    atdglhenetlaslkseaeslkgkleeeraklhdvelhqvaervealgqfvmktrrtlkg
    hgnkvlcmdwckdkrrivsssqdgkvivwdsfttnkehavtmpctwvmacayapsgcaia
    cggldnkcsvypltfdknenmaakkksvamhtnylsacsftnsdmqiltasgdgtcalwd
    vesgqllqsfhghgadvlcldlapsetgntfvsggcdkkamvwdmrsgqcvqafethesd
    vnsvryypsgdafasgsddatcrlydlradrevaiyskesiifgassvdfslsgrllfag
    yndytinvwdvlkgsrvsilfghenrvstlrvspdgtafcsgswdhtlrvwa