PDB entry 6n6g

View 6n6g on RCSB PDB site
Description: vibrio cholerae oligoribonuclease bound to pcg
Deposited on 2018-11-26, released 2019-06-12
The last revision was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oligoribonuclease
    Species: Vibrio cholerae [TaxId:666]
    Gene: ORN
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: RNA (5'-r(p*cp*g)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6n6gA (A:)
    msfsdqnliwidlemtgldpemhkiiemativtdselnilaegpviaihqpeselakmde
    wcttthtasglvarvrqsqvseeeaidqtlaflkqwvpegkspicgnsigqdrrflykhm
    prleayfhyryidvstikeltrrwqpevlkefsktgshlalddiresiaelqfyrkavfk
    i
    

  • Chain 'D':
    No sequence available.