PDB entry 6n59

View 6n59 on RCSB PDB site
Description: 1.0 Angstrom crystal structure of [FeFe]-hydrogenase
Class: oxidoreductase
Keywords: [FeFe]-hydrogenase, reactivity of [FeFe]-hydrogenase, Clostridium pasteurianum, iron sulfur clusters, electron-transfer, catalysis, OXIDOREDUCTASE
Deposited on 2018-11-21, released 2019-12-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-05, with a file datestamp of 2020-01-31.
Experiment type: XRAY
Resolution: 1.02 Å
R-factor: N/A
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Iron hydrogenase 1
    Species: Clostridium pasteurianum [TaxId:1501]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6n59a1, d6n59a2, d6n59a3
  • Heterogens: 402, SF4, FES, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6n59A (A:)
    mktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvt
    acdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykara
    skpflpkdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigae
    dekcfddtncllcgqciiacpvaalsekshmdrvknalnapekhvivamapsvrasigel
    fnmgfgvdvtgkiytalrqlgfdkifdinfgadmtimeeatelvqrienngpfpmftscc
    pgwvrqaenyypellnnlssakspqqifgtasktyypsisgldpknvftvtvmpctskkf
    eadrpqmekdglrdidavittrelakmikdakipfakledseadpamgeysgagaifgat
    ggvmeaalrsakdfaenaeledieykqvrglngikeaeveinnnkynvavingasnlfkf
    mksgminekqyhfievmachggcvngggqphvnpkdlekvdikkvrasvlynqdehlskr
    kshentalvkmyqnyfgkpgegraheilhfkykk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n59A (A:)
    ktiiingvqfntedttilkfardnnidisalcflnncnndinkceictvevegtglvtac
    dtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykarask
    pflpkdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigaede
    kcfddtncllcgqciiacpvaalsekshmdrvknalnapkhvivamapsvrasigelfnm
    gfgvdvtgkiytalrqlgfdkifdinfgadmtimeeatelvqrienngpfpmftsccpgw
    vrqaenyypellnnlssakspqqifgtasktyypsisgldpknvftvtvmpctskkfead
    rpqmekdglrdidavittrelakmikdakipfakledseadpamgeysgagaifgatggv
    meaalrsakdfaenaeledieykqvrglngikeaeveinnnkynvavingasnlfkfmks
    gminekqyhfievmachggcvngggqphvnpkdlekvdikkvrasvlynqdehlskrksh
    entalvkmyqnyfgkpgegraheilhfkykk