PDB entry 6n3e

View 6n3e on RCSB PDB site
Description: structure of hiv tat-specific factor 1 u2af homology motif bound to u2af ligand motif 4
Deposited on 2018-11-15, released 2019-01-02
The last revision was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HIV Tat-specific factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HTATSF1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: SF3b1 U2AF ligand motif
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6N3E (0-6)
  • Heterogens: GOL, FMT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6n3eA (A:)
gsmrhervviiknmfhpmdfeddplvlneiredlrvecskfgqirklllfdrhpdgvasv
sfrdpeeadyciqtldgrwfggrqitaqawdgttdy

    Sequence, based on observed residues (ATOM records):
    >6n3eA (A:)
mrhervviiknmfhpmdfeddplvlneiredlrvecskfgqirklllfdrhpdgvasvsf
rdpeeadyciqtldgrwfggrqitaqawdgttdy

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6n3eB (B:)
nrwdetp