PDB entry 6n3d

View 6n3d on RCSB PDB site
Description: structure of hiv tat-specific factor 1 u2af homology motif (apo-state)
Deposited on 2018-11-15, released 2019-01-02
The last revision was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: XRAY
Resolution: 1.13 Å
R-factor: N/A
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HIV Tat-specific factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HTATSF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43719 (2-95)
      • expression tag (0-1)
  • Heterogens: CL, PEG, MG, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6n3dA (A:)
gsmrhervviiknmfhpmdfeddplvlneiredlrvecskfgqirklllfdrhpdgvasv
sfrdpeeadyciqtldgrwfggrqitaqawdgttdy