PDB entry 6n36

View 6n36 on RCSB PDB site
Description: Beta-lactamase from Chitinophaga pinensis
Class: ligase
Keywords: beta-lactamase, structural genomics, IDP97256, Center for Structural Genomics of Infectious Diseases, CSGID, LIGASE
Deposited on 2018-11-14, released 2018-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Chitinophaga pinensis [TaxId:485918]
    Gene: Cpin_4572
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6n36a_
  • Heterogens: ZN, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6n36A (A:)
    snaqklikdlyvdkewsadyqpfriagnlyyigtydlgmflittpkghilintgvagsdt
    likahmktlgfkfkdirilltthahydhvgamaavkqqthakmmvnekdaalladggnsd
    yvmggkgsmflpvkadrllhdgdsiqlggmkivmrqhpghtpgansflfdvkdavrtykv
    lianipsilndtklsgmplypevgkdyaytlkamkalkfdlwlaphagqyelhkkhqpgd
    aynpaafsdragyddvldewqqiydkrvkee
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n36A (A:)
    likdlyvdkewsadyqpfriagnlyyigtydlgmflittpkghilintgvagsdtlikah
    mktlgfkfkdirilltthahydhvgamaavkqqthakmmvnekdaalladggnsdyvmgg
    kgsmflpvkadrllhdgdsiqlggmkivmrqhpghtpgansflfdvkdavrtykvliani
    psilndtklsgmplypevgkdyaytlkamkalkfdlwlaphagqyelhkkhqpgdaynpa
    afsdragyddvldewqqiydkrvke