PDB entry 6n35

View 6n35 on RCSB PDB site
Description: anti-hiv-1 fab 2g12 + man1-2 re-refinement
Deposited on 2018-11-14, released 2018-11-28
The last revision was dated 2018-11-28, with a file datestamp of 2018-11-23.
No data on structure quality are available

Chains and heterogens:

  • Chain 'H':
    Compound: Fab 2G12 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6N35 (0-122)
    • Uniprot P0DOX5 (123-223)
  • Chain 'K':
    Compound: Fab 2G12 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6N35 (0-107)
    • Uniprot P0DOX7 (108-212)
  • Chain 'L':
    Compound: Fab 2G12 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6N35 (Start-107)
    • Uniprot P0DOX7 (108-End)
  • Chain 'M':
    Compound: Fab 2G12 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6N35 (0-122)
    • Uniprot P0DOX5 (123-223)
  • Heterogens: BEZ, MAN, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.04, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'H':
    Sequence, based on SEQRES records:
    >6n35H (H:)
    evqlvesggglvkaggslilscgvsnfrisahtmnwvrrvpggglewvasistsstyrdy
    adavkgrftvsrddledfvylqmhkmrvedtaiyycarkgsdrlsdndpfdawgpgtvvt
    vspastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

    Sequence, based on observed residues (ATOM records):
    >6n35H (H:)
    evqlvesggglvkaggslilscgvsnfrisahtmnwvrrvpggglewvasistsstyrdy
    adavkgrftvsrddledfvylqmhkmrvedtaiyycarkgsdrlsdndpfdawgpgtvvt
    vspastkgpsvfplapsgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
    slssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records:
    >6n35K (K:)
    dvvmtqspstlsasvgdtititcrasqsietwlawyqqkpgkapklliykastlktgvps
    rfsgsgsgteftltisglqfddfatyhcqhyagysatfgqgtrveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >6n35L (L:)
    dvvmtqspstlsasvgdtititcrasqsietwlawyqqkpgkapklliykastlktgvps
    rfsgsgsgteftltisglqfddfatyhcqhyagysatfgqgtrveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

    Sequence, based on observed residues (ATOM records):
    >6n35L (L:)
    vvmtqspstlsasvgdtititcrasqsietwlawyqqkpgkapklliykastlktgvpsr
    fsgsgsgteftltisglqfddfatyhcqhyagysatfgqgtrveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >6n35M (M:)
    evqlvesggglvkaggslilscgvsnfrisahtmnwvrrvpggglewvasistsstyrdy
    adavkgrftvsrddledfvylqmhkmrvedtaiyycarkgsdrlsdndpfdawgpgtvvt
    vspastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

    Sequence, based on observed residues (ATOM records):
    >6n35M (M:)
    evqlvesggglvkaggslilscgvsnfrisahtmnwvrrvpggglewvasistsstyrdy
    adavkgrftvsrddledfvylqmhkmrvedtaiyycarkgsdrlsdndpfdawgpgtvvt
    vspastkgpsvfplapsgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
    slssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk