PDB entry 6n2x

View 6n2x on RCSB PDB site
Description: Anti-HIV-1 Fab 2G12 + Man9 re-refinement
Class: immune system
Keywords: antibody, carbohydrate, HIV-1, IMMUNE SYSTEM
Deposited on 2018-11-14, released 2018-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab 2G12 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6N2X (0-122)
    • Uniprot P0DOX5 (123-223)
  • Chain 'K':
    Compound: Fab 2G12 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6N2X (0-107)
    • Uniprot P0DOX7 (108-212)
    Domains in SCOPe 2.08: d6n2xk1, d6n2xk2
  • Chain 'L':
    Compound: Fab 2G12 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6N2X (0-107)
    • Uniprot P0DOX7 (108-212)
    Domains in SCOPe 2.08: d6n2xl1, d6n2xl2
  • Chain 'M':
    Compound: Fab 2G12 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6N2X (0-122)
    • Uniprot P0DOX5 (123-223)

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6n2xK (K:)
dvvmtqspstlsasvgdtititcrasqsietwlawyqqkpgkapklliykastlktgvps
rfsgsgsgteftltisglqfddfatyhcqhyagysatfgqgtrveikrtvaapsvfifpp
sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
lskadyekhkvyacevthqglsspvtksfnrge

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6n2xL (L:)
dvvmtqspstlsasvgdtititcrasqsietwlawyqqkpgkapklliykastlktgvps
rfsgsgsgteftltisglqfddfatyhcqhyagysatfgqgtrveikrtvaapsvfifpp
sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
lskadyekhkvyacevthqglsspvtksfnrge

  • Chain 'M':
    No sequence available.