PDB entry 6n2u

View 6n2u on RCSB PDB site
Description: IL-8 Structure from Bacterial Expression Source
Class: immune system
Keywords: il-8, immune system
Deposited on 2018-11-14, released 2019-11-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: N/A
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-8
    Species: Homo sapiens [TaxId:9606]
    Gene: CXCL8, IL8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6n2ua_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6n2uA (A:)
mtsklavallaaflisaalcegavlprsakelrcqciktyskpfhpkfikelrviesgph
canteiivklsdgrelcldpkenwvqrvvekflkraens

    Sequence, based on observed residues (ATOM records): (download) 
    >6n2uA (A:)
kelrcqciktyskpfhpkfikelrviesgphcanteiivklsdgrelcldpkenwvqrvv
ekflkraen