PDB entry 6n2m

View 6n2m on RCSB PDB site
Description: nmr solution structure of the homodimeric, autoinhibited state of the card9 card and first coiled-coil
Deposited on 2018-11-13, released 2019-07-17
The last revision was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Caspase recruitment domain-containing protein 9
    Species: Homo sapiens [TaxId:9606]
    Gene: CARD9
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H257 (1-141)
      • expression tag (0)
  • Chain 'B':
    Compound: Caspase recruitment domain-containing protein 9
    Species: Homo sapiens [TaxId:9606]
    Gene: CARD9
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H257 (1-141)
      • expression tag (0)
  • Heterogens: ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6n2mA (A:)
gsdyenddecwsvlegfrvtltsvidpsritpylrqckvlnpddeeqvlsdpnlvirkrk
vgvlldilqrtghkgyvafleslelyypqlykkvtgkeparvfsmiidasgesgltqllm
tevmklqkkvqdltallsskdd

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6n2mB (B:)
gsdyenddecwsvlegfrvtltsvidpsritpylrqckvlnpddeeqvlsdpnlvirkrk
vgvlldilqrtghkgyvafleslelyypqlykkvtgkeparvfsmiidasgesgltqllm
tevmklqkkvqdltallsskdd