PDB entry 6n1z

View 6n1z on RCSB PDB site
Description: Importin-9 bound to H2A-H2B
Class: transport protein
Keywords: Importin-9, karyopherin, histone, H2A, H2B, histone chaperone, Ran GTPase, nucleosome, NLS, nuclear pore complex., TRANSPORT PROTEIN
Deposited on 2018-11-12, released 2019-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-20, with a file datestamp of 2019-03-15.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Importin-9
    Species: Homo sapiens [TaxId:9606]
    Gene: IPO9, IMP9, KIAA1192, RANBP9, HSPC273
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: histone h2a
    Species: Xenopus laevis [TaxId:8355]
    Gene: hist1h2aj, LOC494591, XELAEV_18003602mg
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Histone H2B 1.1
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6n1zc_
  • Chain 'D':
    Compound: Importin-9
    Species: Homo sapiens [TaxId:9606]
    Gene: IPO9, IMP9, KIAA1192, RANBP9, HSPC273
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: histone h2a
    Species: Xenopus laevis [TaxId:8355]
    Gene: hist1h2aj, LOC494591, XELAEV_18003602mg
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Histone H2B 1.1
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02281
      • engineered mutation (29)
    Domains in SCOPe 2.07: d6n1zf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6n1zC (C:)
    maksapapkkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskamsim
    nsfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtkyt
    sak
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n1zC (C:)
    krrrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynstits
    reiqtavrlllpgelakhavsegtkavtkyts
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6n1zF (F:)
    maksapapkkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskamsim
    nsfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtkyt
    sak
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n1zF (F:)
    kkrrktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkr
    stitsreiqtavrlllpgelakhavsegtkavtkyts