PDB entry 6n08

View 6n08 on RCSB PDB site
Description: Crystal structure of hemagglutinin from influenza virus A/Netherlands/209/1980 (H3N2)
Class: viral protein
Keywords: hemagglutinin influenza crystal structure, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, VIRAL PROTEIN
Deposited on 2018-11-06, released 2019-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Netherlands/209/1980(H3N2)) [TaxId:1086943]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6n08a1, d6n08a2
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Netherlands/209/1980(H3N2)) [TaxId:1086943]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6n08b1, d6n08b2
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Netherlands/209/1980(H3N2)) [TaxId:1086943]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6n08c1, d6n08c2
  • Heterogens: NAG, BMA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6n08A (A:)
    nstatlclghhavpngtlvktitndqievtnatelvqssstgricdsphrildgknctlv
    dallgdphcdgfqnekwdlfverskafsncypydvpdyaslrslvassgtlefinesfnw
    tgvtqsggsyackrgsdnsffsrlnwlyeseskypvlnvtmpnngnfdklyiwgvhhpst
    dkeqtnlyvrasgrvtvstkrsqqtiipnigsrpwvrglssrisiywtivkpgdillins
    ngnliaprgyfkirtgkssimrsdapigtcssecitpngsipndkpfqnvnkitygacpk
    yvkqntlklatgmrnvpekqtrgifgaiagfiengwegmvdgwygfrhqnsegtgqaadl
    kstqaaidqingklnrviektnekfhqiekefsevegriqdlekyvedtkidlwsynael
    lvalenqhtidltdsemnklfektrrqlrenaedmgngcfkiyhkcdnacigsirngtyd
    hdvyrdealnnrfqikg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n08A (A:)
    nstatlclghhavpngtlvktitndqievtnatelvqssstgricdsphrildgknctlv
    dallgdphcdgfqnekwdlfverskafsncypydvpdyaslrslvassgtlefinesfnw
    tgvtqsggsyackrgsdnsffsrlnwlyeseskypvlnvtmpnngnfdklyiwgvhhpst
    dkeqtnlyvrasgrvtvstkrsqqtiipnigsrpwvrglssrisiywtivkpgdillins
    ngnliaprgyfkirtgkssimrsdapigtcssecitpngsipndkpfqnvnkitygacpk
    yvkqntlklatgmrnvpekaiagfiengwegmvdgwygfrhqnsegtgqaadlkstqaai
    dqingklnrviektnekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenq
    htidltdsemnklfektrrqlrenaedmgngcfkiyhkcdnacigsirngtydhdvyrde
    alnnrfqi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6n08B (B:)
    nstatlclghhavpngtlvktitndqievtnatelvqssstgricdsphrildgknctlv
    dallgdphcdgfqnekwdlfverskafsncypydvpdyaslrslvassgtlefinesfnw
    tgvtqsggsyackrgsdnsffsrlnwlyeseskypvlnvtmpnngnfdklyiwgvhhpst
    dkeqtnlyvrasgrvtvstkrsqqtiipnigsrpwvrglssrisiywtivkpgdillins
    ngnliaprgyfkirtgkssimrsdapigtcssecitpngsipndkpfqnvnkitygacpk
    yvkqntlklatgmrnvpekqtrgifgaiagfiengwegmvdgwygfrhqnsegtgqaadl
    kstqaaidqingklnrviektnekfhqiekefsevegriqdlekyvedtkidlwsynael
    lvalenqhtidltdsemnklfektrrqlrenaedmgngcfkiyhkcdnacigsirngtyd
    hdvyrdealnnrfqikg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n08B (B:)
    nstatlclghhavpngtlvktitndqievtnatelvqssstgricdsphrildgknctlv
    dallgdphcdgfqnekwdlfverskafsncypydvpdyaslrslvassgtlefinesfnw
    tgvtqsggsyackrgsdnsffsrlnwlyeseskypvlnvtmpnngnfdklyiwgvhhpst
    dkeqtnlyvrasgrvtvstkrsqqtiipnigsrpwvrglssrisiywtivkpgdillins
    ngnliaprgyfkirtgkssimrsdapigtcssecitpngsipndkpfqnvnkitygacpk
    yvkqntlklatgmrnvpekaiagfiengwegmvdgwygfrhqnsegtgqaadlkstqaai
    dqingklnrviektnekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenq
    htidltdsemnklfektrrqlrenaedmgngcfkiyhkcdnacigsirngtydhdvyrde
    alnnrfqi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6n08C (C:)
    nstatlclghhavpngtlvktitndqievtnatelvqssstgricdsphrildgknctlv
    dallgdphcdgfqnekwdlfverskafsncypydvpdyaslrslvassgtlefinesfnw
    tgvtqsggsyackrgsdnsffsrlnwlyeseskypvlnvtmpnngnfdklyiwgvhhpst
    dkeqtnlyvrasgrvtvstkrsqqtiipnigsrpwvrglssrisiywtivkpgdillins
    ngnliaprgyfkirtgkssimrsdapigtcssecitpngsipndkpfqnvnkitygacpk
    yvkqntlklatgmrnvpekqtrgifgaiagfiengwegmvdgwygfrhqnsegtgqaadl
    kstqaaidqingklnrviektnekfhqiekefsevegriqdlekyvedtkidlwsynael
    lvalenqhtidltdsemnklfektrrqlrenaedmgngcfkiyhkcdnacigsirngtyd
    hdvyrdealnnrfqikg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n08C (C:)
    nstatlclghhavpngtlvktitndqievtnatelvqssstgricdsphrildgknctlv
    dallgdphcdgfqnekwdlfverskafsncypydvpdyaslrslvassgtlefinesfnw
    tgvtqsggsyackrgsdnsffsrlnwlyeseskypvlnvtmpnngnfdklyiwgvhhpst
    dkeqtnlyvrasgrvtvstkrsqqtiipnigsrpwvrglssrisiywtivkpgdillins
    ngnliaprgyfkirtgkssimrsdapigtcssecitpngsipndkpfqnvnkitygacpk
    yvkqntlklatgmrnvpekaiagfiengwegmvdgwygfrhqnsegtgqaadlkstqaai
    dqingklnrviektnekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenq
    htidltdsemnklfektrrqlrenaedmgngcfkiyhkcdnacigsirngtydhdvyrde
    alnnrfqi