PDB entry 6mza

View 6mza on RCSB PDB site
Description: solution nmr structure of a putative thioredoxin (trxa) in the reduced state from rickettsia prowazekii, the etiological agent responsible for typhus. seattle structural genomics center for infectious disease target ripra.00029.a
Deposited on 2018-11-04, released 2018-12-12
The last revision was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Rickettsia prowazekii (strain Madrid E) [TaxId:272947]
    Gene: trxA, RP002
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZEE0 (29-133)
      • expression tag (0-28)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6mzaA (A:)
gpgsmscyneittllefdsndinttqrinmvnnvtdssfknevlesdlpvmvdfwaewcg
pckmlipiideiskelqdkvkvlkmnidenpktpseygirsiptimlfkngeqkdtkigl
qqknslldwinksi