PDB entry 6mxu

View 6mxu on RCSB PDB site
Description: Crystal structure of hemagglutinin from influenza virus A/Texas/1/1977 (H3N2)
Class: viral protein
Keywords: viral protein, hemagglutinin, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID
Deposited on 2018-10-31, released 2019-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Texas/1/1977(H3N2)) [TaxId:444318]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6mxua1, d6mxua2
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Texas/1/1977(H3N2)) [TaxId:444318]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6mxub1, d6mxub2
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Texas/1/1977(H3N2)) [TaxId:444318]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6mxuc1, d6mxuc2
  • Heterogens: NAG, BMA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6mxuA (A:)
    nstatlclghhavpngtlvktitndqievtnatelvqssstgricdsphrildgknctli
    dallgdphcdgfqnekwdlfverskafsncypydvpdyaslrslvassgtlefinegfnw
    tgvtqnggsyackrgpdnsffsrlnwlyksestypvlnvtmpnndnfdklyiwgvhhpst
    dkeqtnlyvqasgrvtvstkrsqqtiipnvgsrpwvrglssgisiywtivkpgdillins
    ngnliaprgyfkirtgkssimrsdapigtcssecitpngsipndkpfqnvnkitygacpk
    yvkqntlklatgmrnvpekqtrgifgaiagfiengwegmidgwygfrhqnsegtgqaadl
    kstqaaidqingklnrviektnekfhqiekefsevegriqdlekyvedtkidlwsynael
    lvalenqhtidltdsemnklfektrrqlrenaedmgngcfkiyhkcdnacigsirngtyd
    hdvyrdealnnrfqikg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mxuA (A:)
    statlclghhavpngtlvktitndqievtnatelvqssstgricdsphrildgknctlid
    allgdphcdgfqnekwdlfverskafsncypydvpdyaslrslvassgtlefinegfnwt
    gvtqnggsyackrgpdnsffsrlnwlyksestypvlnvtmpnndnfdklyiwgvhhpstd
    keqtnlyvqasgrvtvstkrsqqtiipnvgsrpwvrglssgisiywtivkpgdillinsn
    gnliaprgyfkirtgkssimrsdapigtcssecitpngsipndkpfqnvnkitygacpky
    vkqntlklatgmrnvpeaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidq
    ingklnrviektnekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqht
    idltdsemnklfektrrqlrenaedmgngcfkiyhkcdnacigsirngtydhdvyrdeal
    nnrfqi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6mxuB (B:)
    nstatlclghhavpngtlvktitndqievtnatelvqssstgricdsphrildgknctli
    dallgdphcdgfqnekwdlfverskafsncypydvpdyaslrslvassgtlefinegfnw
    tgvtqnggsyackrgpdnsffsrlnwlyksestypvlnvtmpnndnfdklyiwgvhhpst
    dkeqtnlyvqasgrvtvstkrsqqtiipnvgsrpwvrglssgisiywtivkpgdillins
    ngnliaprgyfkirtgkssimrsdapigtcssecitpngsipndkpfqnvnkitygacpk
    yvkqntlklatgmrnvpekqtrgifgaiagfiengwegmidgwygfrhqnsegtgqaadl
    kstqaaidqingklnrviektnekfhqiekefsevegriqdlekyvedtkidlwsynael
    lvalenqhtidltdsemnklfektrrqlrenaedmgngcfkiyhkcdnacigsirngtyd
    hdvyrdealnnrfqikg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mxuB (B:)
    nstatlclghhavpngtlvktitndqievtnatelvqssstgricdsphrildgknctli
    dallgdphcdgfqnekwdlfverskafsncypydvpdyaslrslvassgtlefinegfnw
    tgvtqnggsyackrgpdnsffsrlnwlyksestypvlnvtmpnndnfdklyiwgvhhpst
    dkeqtnlyvqasgrvtvstkrsqqtiipnvgsrpwvrglssgisiywtivkpgdillins
    ngnliaprgyfkirtgkssimrsdapigtcssecitpngsipndkpfqnvnkitygacpk
    yvkqntlklatgmrnvpeaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaid
    qingklnrviektnekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqh
    tidltdsemnklfektrrqlrenaedmgngcfkiyhkcdnacigsirngtydhdvyrdea
    lnnrfqik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6mxuC (C:)
    nstatlclghhavpngtlvktitndqievtnatelvqssstgricdsphrildgknctli
    dallgdphcdgfqnekwdlfverskafsncypydvpdyaslrslvassgtlefinegfnw
    tgvtqnggsyackrgpdnsffsrlnwlyksestypvlnvtmpnndnfdklyiwgvhhpst
    dkeqtnlyvqasgrvtvstkrsqqtiipnvgsrpwvrglssgisiywtivkpgdillins
    ngnliaprgyfkirtgkssimrsdapigtcssecitpngsipndkpfqnvnkitygacpk
    yvkqntlklatgmrnvpekqtrgifgaiagfiengwegmidgwygfrhqnsegtgqaadl
    kstqaaidqingklnrviektnekfhqiekefsevegriqdlekyvedtkidlwsynael
    lvalenqhtidltdsemnklfektrrqlrenaedmgngcfkiyhkcdnacigsirngtyd
    hdvyrdealnnrfqikg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mxuC (C:)
    nstatlclghhavpngtlvktitndqievtnatelvqssstgricdsphrildgknctli
    dallgdphcdgfqnekwdlfverskafsncypydvpdyaslrslvassgtlefinegfnw
    tgvtqnggsyackrgpdnsffsrlnwlyksestypvlnvtmpnndnfdklyiwgvhhpst
    dkeqtnlyvqasgrvtvstkrsqqtiipnvgsrpwvrglssgisiywtivkpgdillins
    ngnliaprgyfkirtgkssimrsdapigtcssecitpngsipndkpfqnvnkitygacpk
    yvkqntlklatgmrnvpgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaid
    qingklnrviektnekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqh
    tidltdsemnklfektrrqlrenaedmgngcfkiyhkcdnacigsirngtydhdvyrdea
    lnnrfqik