PDB entry 6mxg

View 6mxg on RCSB PDB site
Description: Crystal structure of Trypanosoma brucei hypoxanthine-guanine phosphoribosyltranferase in complex with XMP
Class: transferase
Keywords: 6-oxopurine PRTs, Purine salvage, TRANSFERASE
Deposited on 2018-10-30, released 2019-07-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypoxanthine-guanine phosphoribosyltransferase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Gene: HGPRT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6mxga_
  • Chain 'B':
    Compound: hypoxanthine-guanine phosphoribosyltransferase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Gene: HGPRT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6mxgb_
  • Heterogens: XMP, MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6mxgA (A:)
    hhhhhhmepackydfatsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlk
    gsfvftadmvrilgdfgvptrveflrassyghdtkscgrvdvkadglcdirgkhvlvled
    ildtaltlrevvdslkksepasiktlvaidkpggrkipftaeyvvadvpnvfvvgygldy
    dqsyrevrdvvilkpsvyetwgkelerrkaageakr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mxgA (A:)
    ackydfatsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlkgsfvftadm
    vrilgdfgvptrveflrirgkhvlvledildtaltlrevvdslkksepasiktlvaidkp
    ggrkipftaeyvvadvpnvfvvgygldydqsyrevrdvvilkpsvyetwgk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6mxgB (B:)
    hhhhhhmepackydfatsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlk
    gsfvftadmvrilgdfgvptrveflrassyghdtkscgrvdvkadglcdirgkhvlvled
    ildtaltlrevvdslkksepasiktlvaidkpggrkipftaeyvvadvpnvfvvgygldy
    dqsyrevrdvvilkpsvyetwgkelerrkaageakr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mxgB (B:)
    ckydfatsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlkgsfvftadmv
    rilgdfgvptrveflrrgkhvlvledildtaltlrevvdslkksepasiktlvaidkpgg
    rkipftaeyvvadvpnvfvvgygldydqsyrevrdvvilkpsvyetwgkele