PDB entry 6mv6

View 6mv6 on RCSB PDB site
Description: Crystal structure of RNAse 6
Class: hydrolase
Keywords: rnase, nuclease, HYDROLASE
Deposited on 2018-10-24, released 2019-11-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-11-13, with a file datestamp of 2019-11-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease K6
    Species: Homo sapiens [TaxId:9606]
    Gene: RNASE6, RNS6
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93091 (1-125)
      • expression tag (0)
    Domains in SCOPe 2.07: d6mv6a1, d6mv6a2
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6mv6A (A:)
    akrltkahwfeiqhiqpsplqcnramsginnytqhckhqntflhdsfqnvaavcdllsiv
    cknrrhnchqsskpvnmtdcrltsgkypqcrysaaaqykffivacdppqksdppyklvpv
    hldsil
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mv6A (A:)
    akrltkahwfeiqhiqpsplqcnramsginnytqhckhqntflhdsfqnvaavcdllsiv
    cknrrhnchqsskpvnmtdcrltypqcrysaaaqykffivacdppqksdppyklvpvhld
    sil