PDB entry 6mub

View 6mub on RCSB PDB site
Description: anti-hiv-1 fab 2g12 + man5 re-refinement
Deposited on 2018-10-22, released 2018-10-31
The last revision was dated 2018-10-31, with a file datestamp of 2018-10-26.
No data on structure quality are available

Chains and heterogens:

  • Chain 'H':
    Compound: FAB 2G12, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6MUB (0-122)
    • Uniprot P0DOX5 (123-End)
  • Chain 'K':
    Compound: FAB 2G12, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6MUB (0-108)
    • Uniprot P0DOX7 (109-212)
  • Chain 'L':
    Compound: FAB 2G12, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6MUB (0-108)
    • Uniprot P0DOX7 (109-End)
  • Chain 'M':
    Compound: FAB 2G12, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6MUB (0-122)
    • Uniprot P0DOX5 (123-End)
  • Heterogens: BMA, MAN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.05, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'H':
    Sequence, based on SEQRES records:
    >6mubH (H:)
    evqlvesggglvkaggslilscgvsnfrisahtmnwvrrvpggglewvasistsstyrdy
    adavkgrftvsrddledfvylqmhkmrvedtaiyycarkgsdrlsdndpfdawgpgtvvt
    vspastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

    Sequence, based on observed residues (ATOM records):
    >6mubH (H:)
    evqlvesggglvkaggslilscgvsnfrisahtmnwvrrvpggglewvasistsstyrdy
    adavkgrftvsrddledfvylqmhkmrvedtaiyycarkgsdrlsdndpfdawgpgtvvt
    vspastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records:
    >6mubK (K:)
    dvvmtqspstlsasvgdtititcrasqsietwlawyqqkpgkapklliykastlktgvps
    rfsgsgsgteftltisglqfddfatyhcqhyagysatfgqgtrveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >6mubL (L:)
    dvvmtqspstlsasvgdtititcrasqsietwlawyqqkpgkapklliykastlktgvps
    rfsgsgsgteftltisglqfddfatyhcqhyagysatfgqgtrveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

    Sequence, based on observed residues (ATOM records):
    >6mubL (L:)
    dvvmtqspstlsasvgdtititcrasqsietwlawyqqkpgkapklliykastlktgvps
    rfsgsgsgteftltisglqfddfatyhcqhyagysatfgqgtrveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >6mubM (M:)
    evqlvesggglvkaggslilscgvsnfrisahtmnwvrrvpggglewvasistsstyrdy
    adavkgrftvsrddledfvylqmhkmrvedtaiyycarkgsdrlsdndpfdawgpgtvvt
    vspastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

    Sequence, based on observed residues (ATOM records):
    >6mubM (M:)
    evqlvesggglvkaggslilscgvsnfrisahtmnwvrrvpggglewvasistsstyrdy
    adavkgrftvsrddledfvylqmhkmrvedtaiyycarkgsdrlsdndpfdawgpgtvvt
    vspastkgpsvfplapsgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
    slssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks