PDB entry 6mu3

View 6mu3 on RCSB PDB site
Description: Anti-HIV-1 Fab 2G12 + Man7 re-refinement
Class: immune system
Keywords: antibody, carbohydrate, HIV-1, IMMUNE SYSTEM
Deposited on 2018-10-22, released 2018-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-31, with a file datestamp of 2018-10-26.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: FAB 2G12, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6MU3 (0-122)
    • Uniprot P0DOX5 (123-End)
    Domains in SCOPe 2.07: d6mu3h1, d6mu3h2
  • Chain 'K':
    Compound: FAB 2G12, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6MU3 (Start-108)
    • Uniprot P0DOX7 (109-End)
    Domains in SCOPe 2.07: d6mu3k1, d6mu3k2
  • Chain 'L':
    Compound: FAB 2G12, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6MU3 (Start-108)
    • Uniprot P0DOX7 (109-End)
    Domains in SCOPe 2.07: d6mu3l1, d6mu3l2
  • Chain 'M':
    Compound: FAB 2G12, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6MU3 (0-122)
    • Uniprot P0DOX5 (123-End)
    Domains in SCOPe 2.07: d6mu3m1, d6mu3m2
  • Heterogens: BMA, MAN, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6mu3H (H:)
    evqlvesggglvkaggslilscgvsnfrisahtmnwvrrvpggglewvasistsstyrdy
    adavkgrftvsrddledfvylqmhkmrvedtaiyycarkgsdrlsdndpfdawgpgtvvt
    vspastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mu3H (H:)
    evqlvesggglvkaggslilscgvsnfrisahtmnwvrrvpggglewvasistsstyrdy
    adavkgrftvsrddledfvylqmhkmrvedtaiyycarkgsdrlsdndpfdawgpgtvvt
    vspastkgpsvfplapsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
    yslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >6mu3K (K:)
    dvvmtqspstlsasvgdtititcrasqsietwlawyqqkpgkapklliykastlktgvps
    rfsgsgsgteftltisglqfddfatyhcqhyagysatfgqgtrveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mu3K (K:)
    vvmtqspstlsasvgdtititcrasqsietwlawyqqkpgkapklliykastlktgvpsr
    fsgsgsgteftltisglqfddfatyhcqhyagysatfgqgtrveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6mu3L (L:)
    dvvmtqspstlsasvgdtititcrasqsietwlawyqqkpgkapklliykastlktgvps
    rfsgsgsgteftltisglqfddfatyhcqhyagysatfgqgtrveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mu3L (L:)
    vvmtqspstlsasvgdtititcrasqsietwlawyqqkpgkapklliykastlktgvpsr
    fsgsgsgteftltisglqfddfatyhcqhyagysatfgqgtrveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >6mu3M (M:)
    evqlvesggglvkaggslilscgvsnfrisahtmnwvrrvpggglewvasistsstyrdy
    adavkgrftvsrddledfvylqmhkmrvedtaiyycarkgsdrlsdndpfdawgpgtvvt
    vspastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mu3M (M:)
    evqlvesggglvkaggslilscgvsnfrisahtmnwvrrvpggglewvasistsstyrdy
    adavkgrftvsrddledfvylqmhkmrvedtaiyycarkgsdrlsdndpfdawgpgtvvt
    vspastkgpsvfplapstaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
    lssvvtvpssslgtqtyicnvnhkpsntkvdkkvep