PDB entry 6ms3

View 6ms3 on RCSB PDB site
Description: Crystal structure of the GH43 protein BlXynB mutant (K247S) from Bacillus licheniformis
Class: hydrolase
Keywords: glycoside hydrolase, GH43, Bacillus lincheniformis, HYDROLASE
Deposited on 2018-10-16, released 2019-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-17, with a file datestamp of 2019-04-12.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycoside hydrolase family 43
    Species: Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) [TaxId:279010]
    Gene: xynB, BL03023
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q65MB6 (Start-537)
      • engineered mutation (269)
    Domains in SCOPe 2.07: d6ms3a1, d6ms3a2
  • Chain 'B':
    Compound: Glycoside hydrolase family 43
    Species: Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) [TaxId:279010]
    Gene: xynB, BL03023
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q65MB6 (Start-537)
      • engineered mutation (269)
    Domains in SCOPe 2.07: d6ms3b1, d6ms3b2
  • Heterogens: CA, SO4, GOL, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ms3A (A:)
    mgsshhhhhhssglvprgshmasmsgehtytnpvltgfhpdpsiirvgedyymvnstfqy
    fpaivishskdlvhwkiighgitenegldlsdindshgiwapdisyhngtfyifathrln
    gptvingrklirrqimikssrpegpyskpvfidegsgidpshfvdgdgkhymllspactl
    fplneectdisgepvqiwegtgrrapegphllkkdgyyyailaeggtgyshsittarsth
    lygpyepcpynpiltqtdpdapiqraghgslvetqngewwavylcgrpnqgsyttvgret
    aldpvewtddgwfvinnlkgpslvqrapnlpqvkwdeknfddfdedtlgldwqfvrnpdh
    sswslierpgylrlwtgdwdlhdirakntvvrrekhhlysagvkldfspsasgeqagivc
    yystnnylkccliyeeglkikvvenrsgcqktlgkkhaeagplflkavinkqkrdfyysy
    egkhwhhaggtedasflsdegsrdakghtgtmvgifannggsgrkaaadfdwfryiay
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ms3A (A:)
    ehtytnpvltgfhpdpsiirvgedyymvnstfqyfpaivishskdlvhwkiighgitene
    gldlsdindshgiwapdisyhngtfyifathrlngptvingrklirrqimikssrpegpy
    skpvfidegsgidpshfvdgdgkhymllspactlfplneectdisgepvqiwegtgrrap
    egphllkkdgyyyailaeggtgyshsittarsthlygpyepcpynpiltqtdpdapiqra
    ghgslvetqngewwavylcgrpnqgsyttvgretaldpvewtddgwfvinnlkgpslvqr
    apnlpqvkwdeknfddfdedtlgldwqfvrnpdhsswslierpgylrlwtgdwdlhdira
    kntvvrrekhhlysagvkldfspsasgeqagivcyystnnylkccliyeeglkikvvenr
    sgcqktlgkkhaeagplflkavinkqkrdfyysyegkhwhhaggtedasflsdegsrdak
    ghtgtmvgifannggsgrkaaadfdwfryiay
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ms3B (B:)
    mgsshhhhhhssglvprgshmasmsgehtytnpvltgfhpdpsiirvgedyymvnstfqy
    fpaivishskdlvhwkiighgitenegldlsdindshgiwapdisyhngtfyifathrln
    gptvingrklirrqimikssrpegpyskpvfidegsgidpshfvdgdgkhymllspactl
    fplneectdisgepvqiwegtgrrapegphllkkdgyyyailaeggtgyshsittarsth
    lygpyepcpynpiltqtdpdapiqraghgslvetqngewwavylcgrpnqgsyttvgret
    aldpvewtddgwfvinnlkgpslvqrapnlpqvkwdeknfddfdedtlgldwqfvrnpdh
    sswslierpgylrlwtgdwdlhdirakntvvrrekhhlysagvkldfspsasgeqagivc
    yystnnylkccliyeeglkikvvenrsgcqktlgkkhaeagplflkavinkqkrdfyysy
    egkhwhhaggtedasflsdegsrdakghtgtmvgifannggsgrkaaadfdwfryiay
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ms3B (B:)
    htytnpvltgfhpdpsiirvgedyymvnstfqyfpaivishskdlvhwkiighgiteneg
    ldlsdindshgiwapdisyhngtfyifathrlngptvingrklirrqimikssrpegpys
    kpvfidegsgidpshfvdgdgkhymllspactlfplneectdisgepvqiwegtgrrape
    gphllkkdgyyyailaeggtgyshsittarsthlygpyepcpynpiltqtdpdapiqrag
    hgslvetqngewwavylcgrpnqgsyttvgretaldpvewtddgwfvinnlkgpslvqra
    pnlpqvkwdeknfddfdedtlgldwqfvrnpdhsswslierpgylrlwtgdwdlhdirak
    ntvvrrekhhlysagvkldfspsasgeqagivcyystnnylkccliyeeglkikvvenrs
    gcqktlgkkhaeagplflkavinkqkrdfyysyegkhwhhaggtedasflsdegsrdakg
    htgtmvgifannggsgrkaaadfdwfryiay