PDB entry 6mrr

View 6mrr on RCSB PDB site
Description: de novo designed protein foldit1
Deposited on 2018-10-15, released 2019-06-12
The last revision was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: XRAY
Resolution: 1.18 Å
R-factor: N/A
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Foldit1
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 6MRR (0-67)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6mrrA (A:)
gwstelekhreelkeflkkegitnveiridngrlevrveggterlkrfleelrqklekkg
ytvdikie