PDB entry 6mrp

View 6mrp on RCSB PDB site
Description: Structure of the Bovine p85a BH domain R228E mutant
Class: signaling protein
Keywords: GAP protein, SIGNALLING PROTEIN, SIGNALING PROTEIN
Deposited on 2018-10-15, released 2019-01-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-08, with a file datestamp of 2020-01-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol 3-kinase regulatory subunit alpha
    Species: Bos taurus [TaxId:9913]
    Gene: PIK3R1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23727
      • engineered mutation (128)
    Domains in SCOPe 2.08: d6mrpa_
  • Chain 'B':
    Compound: Phosphatidylinositol 3-kinase regulatory subunit alpha
    Species: Bos taurus [TaxId:9913]
    Gene: PIK3R1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23727
      • engineered mutation (128)
    Domains in SCOPe 2.08: d6mrpb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6mrpA (A:)
    gplgsteadsqqastlpdlaeqfappdvapplliklveaiekkglecstlyrtqsssnpa
    elrqlldcdtasldlemfdvhvladafkrylldlpnpvipvavsselislapevqsseey
    iqllkkliespsiphqywltlqyllkhffklsqtssknllnarvlselfspllfrfpaas
    sentehlikiieilistewnerqpapalppkppkpttvan
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mrpA (A:)
    stlpdlaeqfappdvapplliklveaiekkglecstlyrtqsssnpaelrqlldcldlem
    fdvhvladafkrylldlpnpvipvavsselislapevqsseeyiqllkkliespsiphqy
    wltlqyllkhffklsqtssknllnarvlselfspllfrfpaassentehlikiieilist
    ew
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6mrpB (B:)
    gplgsteadsqqastlpdlaeqfappdvapplliklveaiekkglecstlyrtqsssnpa
    elrqlldcdtasldlemfdvhvladafkrylldlpnpvipvavsselislapevqsseey
    iqllkkliespsiphqywltlqyllkhffklsqtssknllnarvlselfspllfrfpaas
    sentehlikiieilistewnerqpapalppkppkpttvan
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mrpB (B:)
    stlpdlaeqfappdvapplliklveaiekkglecstlyrtqsssnpaelrqlldcldlem
    fdvhvladafkrylldlpnpvipvavsselislapevqsseeyiqllkkliespsiphqy
    wltlqyllkhffklsqtssknllnarvlselfspllfrfpssentehlikiieiliste