PDB entry 6mov

View 6mov on RCSB PDB site
Description: Crystal Structure of the All-trans Retinal bound R111K:Y134F:T54V:R132Q:P39Y:R59Y:L121Q Human Cellular Retinoic Acid Binding Protein II in the Dark at 1.75 Angstrom Resolution
Class: lipid binding protein
Keywords: iLBP, Rhodopsin mimic, LIPID BINDING PROTEIN
Deposited on 2018-10-04, released 2019-01-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellular retinoic acid-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CRABP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29373 (0-136)
      • engineered mutation (38)
      • engineered mutation (53)
      • engineered mutation (58)
      • engineered mutation (110)
      • engineered mutation (120)
      • engineered mutation (131)
      • engineered mutation (133)
    Domains in SCOPe 2.08: d6mova_
  • Heterogens: RET, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6movA (A:)
    pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskyaveikqegdtfyikvsttvyt
    teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtkeltndgeli
    qtmtaddvvctqvfvre