PDB entry 6moa

View 6moa on RCSB PDB site
Description: C-terminal bromodomain of human BRD2 in complex with 4-(2-cyclopropyl-7-(6-methylquinolin-5-yl)-1H-benzo[d]imidazol-5-yl)-3,5-dimethylisoxazole inhibitor
Class: transcription/transcription inhibitor
Keywords: Inhibitor, epigenetic reader, bromodomain, transcription-transcription inhibitor complex
Deposited on 2018-10-04, released 2019-01-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 1.27 Å
R-factor: N/A
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Bromodomain-containing protein 2
  Species: Homo sapiens [TaxId:9606]
  Gene: BRD2, KIAA9001, RING3
  Database cross-references and differences (RAF-indexed):
  • Uniprot P25440 (0-End)
  Domains in SCOPe 2.08: d6moaa_
• Heterogens: JW4, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >6moaA (A:)
  lseqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkrkmen
  rdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6moaA (A:)
  lseqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkrkmen
  rdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmp