PDB entry 6mnl

View 6mnl on RCSB PDB site
Description: NMR solution structures of second bromodomain of BRD4 with FOXO3a peptide
Class: transcription
Keywords: BRD4, CDK6, AKT, luminal breast cancer, TRANSCRIPTION
Deposited on 2018-10-02, released 2018-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-12-19, with a file datestamp of 2018-12-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FOXO3a peptide
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6MNL (0-15)
  • Chain 'B':
    Compound: Bromodomain-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD4, HUNK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6mnlb_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6mnlB (B:)
kdvpdsqqhpapeksskvseqlkccsgilkemfakkhaayawpfykpvdvealglhdycd
iikhpmdmstikskleareyrdaqefgadvrlmfsncykynppdhevvamarklqdvfem
rfakmpde