PDB entry 6mmc

View 6mmc on RCSB PDB site
Description: Carbon regulatory PII-like protein SbtB from Cyanobium sp. 7001 bound to ADP
Class: signaling protein
Keywords: PII-like protein, SbtB, regulatory protein, SIGNALING PROTEIN
Deposited on 2018-09-30, released 2019-09-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-09-18, with a file datestamp of 2019-09-13.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbon regulatory PII-like protein SbtB
    Species: Cyanobium sp. PCC 7001 [TaxId:180281]
    Gene: CPCC7001_1671
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6mmca_
  • Heterogens: CL, SO4, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6mmcA (A:)
ssqqvwklviiteeillkkvskiikeagasgytvlaaagegsrnvrstgepsvshaysni
kfevltasreladqiqdkvvakyfddyscityistvealrahkf

    Sequence, based on observed residues (ATOM records): (download) 
    >6mmcA (A:)
qqvwklviiteeillkkvskiikeagasgytvlaaagegsaysnikfevltasreladqi
qdkvvakyfddyscityistvealrahkf