PDB entry 6mle

View 6mle on RCSB PDB site
Description: Crystal structure of the periplasmic Lysine-, Arginine-, Ornithine-binding protein (LAO) from Salmonella typhimurium complexed with arginine
Class: protein binding
Keywords: Periplasmic Binding Protein, LAO, Thermodynamics, Protein Ligand Complex, PROTEIN BINDING
Deposited on 2018-09-27, released 2019-08-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Lysine/arginine/ornithine-binding periplasmic protein
    Species: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) [TaxId:99287]
    Gene: argT, STM2355
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6mlee_
  • Heterogens: ARG, ACT, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6mleE (E:)
    alpqtvrigtdttyapfsskdakgefigfdidlgnemckrmqvkctwvasdfdalipslk
    akkidaiisslsitdkrqqeiafsdklyaadsrliaakgspiqptleslkgkhvgvlqgs
    tqeayandnwrtkgvdvvayanqdliysdltagrldaalqdevaasegflkqpagkeyaf
    agpsvkdkkyfgdgtgvglrkddtelkaafdkaltelrqdgtydkmakkyfdfnvygd