PDB entry 6ml4

View 6ml4 on RCSB PDB site
Description: btb24 zinc fingers 4-8 with 19+1mer dna oligonucleotide (sequence 3)
Deposited on 2018-09-26, released 2019-07-03
The last revision was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc finger and BTB domain-containing protein 24
    Species: Mus musculus [TaxId:10090]
    Gene: Zbtb24, Bif1, Bsg1, Znf450
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q80X44 (5-End)
      • expression tag (3-4)
  • Chain 'E':
    Compound: DNA (5'-d(*ap*cp*gp*cp*ap*gp*gp*tp*cp*cp*tp*gp*gp*ap*cp*gp*ap*ap*gp*c)-3')
    Species: MUS MUSCULUS, synthetic [TaxId:10090]
  • Chain 'F':
    Compound: DNA (5'-d(*tp*gp*cp*tp*tp*cp*gp*tp*cp*cp*ap*gp*gp*ap*cp*cp*tp*gp*cp*g)-3')
    Species: MUS MUSCULUS, synthetic [TaxId:10090]
  • Heterogens: ZN, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6ml4A (A:)
gplgsksftcdqcgkyfsqkrqlkshyrvhtghslpecshchrkfmdvsqlkkhlrthtg
ekpftceicgksftaksslqthirihrgekpyscsicgkcfsdssakrrhcilhtgkkpf
scpecglqfarldnlkahlkihskekhtady

    Sequence, based on observed residues (ATOM records):
    >6ml4A (A:)
gsksftcdqcgkyfsqkrqlkshyrvhtghslpecshchrkfmdvsqlkkhlrthtgekp
ftceicgksftaksslqthirihrgekpyscsicgkcfsdssakrrhcilhtgkkpfscp
ecglqfarldnlkahlkihskek

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.