PDB entry 6mk9

View 6mk9 on RCSB PDB site
Description: X-ray crystal structure of darunavir-resistant-P51 HIV-1 protease in complex with GRL-121
Class: hydrolase/hydrolase inhibitor
Keywords: protease-inhibitor complex, darunavir-resistance, P51, GRL-121, non-peptidic, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2018-09-25, released 2019-10-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot O38893 (0-98)
    • conflict (31-32)
    • conflict (53)
    • conflict (81)
    • conflict (83)
  Domains in SCOPe 2.08: d6mk9a_
• Chain 'B':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot O38893 (0-98)
    • conflict (31-32)
    • conflict (53)
    • conflict (81)
    • conflict (83)
  Domains in SCOPe 2.08: d6mk9b_
• Heterogens: 7O7, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6mk9A (A:)
  pqitlwqrpivtikvggqlrealidtgaddtifeeinlpgrwkpkliggiggfmkvrqyd
  qipieicghqaigtvlvgptpinvigrnmltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6mk9B (B:)
  pqitlwqrpivtikvggqlrealidtgaddtifeeinlpgrwkpkliggiggfmkvrqyd
  qipieicghqaigtvlvgptpinvigrnmltqigctlnf