PDB entry 6mk5

View 6mk5 on RCSB PDB site
Description: solution nmr structure of spider toxin analogue [f5a,m6f,t26l, k28r]gptx-1
Deposited on 2018-09-25, released 2018-12-19
The last revision was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Toxin GTx1-15
    Species: Grammostola porteri, synthetic [TaxId:1749325]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0DL72 (0-33)
      • engineered mutation (4-5)
      • engineered mutation (25)
      • engineered mutation (27)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6mk5A (A:)
    dclgafrkcipdndkccrpnlvcsrlhrwckyvf