PDB entry 6mk4

View 6mk4 on RCSB PDB site
Description: solution nmr structure of spider toxin analogue [e17k]protx-ii
Deposited on 2018-09-25, released 2018-12-19
The last revision was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta/omega-theraphotoxin-Tp2a
    Species: Thrixopelma pruriens, synthetic [TaxId:213387]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P83476 (0-29)
      • engineered mutation (16)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6mk4A (A:)
ycqkwmwtcdserkcckgmvcrlwckkklw